Xrcc3

DNA repair protein XRCC3

349 amino acids

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the RAD21 paralog protein complex CX3 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, CX3 acts downstream of RAD51 recruitment; the complex binds predominantly to the intersection of the four duplex arms of the Holliday junction (HJ) and to junctions of replication forks. Involved in HJ resolution and thus in processing HR intermediates late in the DNA repair process; the function may be linked to the CX3 complex and seems to involve GEN1 during mitotic cell cycle progression. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C (By similarity).

Belongs to the RecA family. RAD51 subfamily.

38.446 kDa

MDLDQLDLNPRITAAVKRGRLKSVKEILCYSGPDLQRLTGLPSHDVQCLLRAASLHLRGSRVLSALHLFQQKESFPEQHQRLSLGCPVLDQFLGGGLPLEGITGLAGCSSAGKTQLALQLCLAVQFPRQYGGLEAGAVYICTEDAFPSKRLWQLIAQQRRLRTDAPEELIEKIRFSNHIFIEHAADVDTLLECVSKKVPILLSRGMARLVVVDSIAAPFRCEFHLQASAIRAKLLLSLGATLRRLSSTFRSPVLCINQVTDMVEDQQSVSRSLGASEERLSPALGITWANQLLMRLMVDRTHEDDVTTGLPRSPVRTLRVLFAPHLPLSSCCYTVSGEGIRGMPGTQSY

XRCC3

DNA repair protein XRCC3

346 amino acids

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the RAD21 paralog protein complex CX3 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, CX3 acts downstream of RAD51 recruitment; the complex binds predominantly to the intersection of the four duplex arms of the Holliday junction (HJ) and to junctions of replication forks. Involved in HJ resolution and thus in processing HR intermediates late in the DNA repair process; the function may be linked to the CX3 complex and seems to involve GEN1 during mitotic cell cycle progression. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C.

Belongs to the RecA family. RAD51 subfamily.

37.85 kDa

MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH

XRCC3

DNA repair protein XRCC3

341 amino acids

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Part of the RAD21 paralog protein complex CX3 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, CX3 acts downstream of RAD51 recruitment; the complex binds predominantly to the intersection of the four duplex arms of the Holliday junction (HJ) and to junctions of replication forks. Involved in HJ resolution and thus in processing HR intermediates late in the DNA repair process; the function may be linked to the CX3 complex and seems to involve GEN1 during mitotic cell cycle progression. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C (By similarity).

Belongs to the RecA family. RAD51 subfamily.

36.755 kDa

MDLDRLDLNPRIVAAVKKAKLRSVKEVLHLSGPDLQRRTHLSSPDVQLLLRASASLLRGHGVCTALHLLRQEGPFPEQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQLPPRHGGLGAGAVYVCTEDAFPSRRLQQLIAQQQRLRADVPGHVISKIRFGHQIFIEHAADVDTLLQCVREKVPVLLARGMARLVVIDSVAAPFRCEFDGAALALRAQRLLALGAELRRLSCAFRSPVLCVNQVTEAVEEQDLVAGPPGMSPALGITWANQLLVRLLADRQRPEEAPLTPPGRTLRVVFAPHLPASSCSYTIAAEGVRGMPGTACS

XRCC3

DNA repair protein XRCC3 homolog

304 amino acids

Plays essential roles in DNA damage repair in both somatic and meiotic cells. It is important for postsynaptic events following pachytene in meiosis. It is also required for DNA cross-links repair and is involved in double strand breaks (DSBs) repair.

Belongs to the RecA family. RAD51 subfamily.

33.732 kDa

MQNGKIKPENLLRRSPTNRKLTTGCEILDGCLRGGISCDSLTEIVAESGCGKTQLCLQLSLCTQLPISHGGLNGSSLYLHSEFPFPFRRLHQLSHTFHQSNPSIYANYNDNPCDHVFVQNVHSVDHLFDIMPRIDGFVGNSKTRFPLKLIVLDSVAALFRSEFDNTPSDLKKRSSLFFKISGKLKQLASKFDLAIVITNQVTDLVETSDGLSGLRIGNLRYLYSSGRRVVPSLGLAWANCVNSRFFISRSDGSIVKDRSEKDENCSSSVSRSAKRRLDIVFSPYLPGSSCEFMITREGICAVQA