XPA

DNA repair protein complementing XP-A cells

273 amino acids

Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation.

Belongs to the XPA family.

31.368 kDa

MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

Xpa

DNA repair protein complementing XP-A cells homolog

272 amino acids

Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation (By similarity).

Belongs to the XPA family.

31.398 kDa

MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARLAARPYPAAAATGGVASVKAAPKMIDTKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTICEECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALRFLVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALEDAKEVRQENREKMKQKKFDKKVKELRRAIRSSVWKRETTTHQHKYGPEENLEDDMYRKTCTLCGHELTYEKM

XPA

DNA repair protein complementing XP-A cells homolog

267 amino acids

Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region (By similarity).

Belongs to the XPA family.

30.978 kDa

MGRAAPGPDEGAEGERPSISATALARMERNRRRALALRQARLAARPYPQAAAGAGPPQGRDTGGGFFLEEEEEEEEQRRAAERIVHPPAPVLQFDYLICGDCGKEFMDSYLMQHFDWATCDNCRDAEDKHKLITRTEAKEEYLLKDCDLDKREPVLRFIVKKNPHNPRWGDMKLYLKLQVIKRALEVWGNEESLQEAKEQRRDSREKMKQKRFDKKVKELRRAVRSSLWKKTASIHEHEYGPEENVDEETYKKTCTVCGHELTYEKM

xpa

DNA repair protein complementing XP-A cells homolog

267 amino acids

Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region (By similarity).

Belongs to the XPA family.

31.18 kDa

MEPEPEPEQEANKEEEKILSAAVRAKIERNRQRALMLRQARLACRPYPTGEGISTVKAPPKVIDSGGGFFIEEEEAEEQHVENVVRQPGPVLECDYLICEECGKDFMDSYLSNHFDLAVCDSCRDAEEKHKLITRTEAKQEYLLKDCDIDKREPVLKFILKKNPHNTHWGDMKLYLKAQVIKRSLEVWGSEEALEEAKEVRKDNRDKMKQKKFDKKVKELRRTVRSSLWKKEASGHQHEYGPEEHVEEDSYKKTCITCGYEMNYEKM

XPA

DNA repair protein complementing XP-A cells homolog

97 amino acids

Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation (By similarity).

Belongs to the XPA family.

11.519 kDa

single

SYLMNHFDLPTCDSCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALRFIVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQDALEDAKEVRQENR