Wisp2

WNT1-inducible-signaling pathway protein 2

251 amino acids

May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).

Belongs to the CCN family.

27.095 kDa

MRGNPLIHLLAISFLCILSMVYSQLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

WISP2

WNT1-inducible-signaling pathway protein 2

250 amino acids

May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.

Belongs to the CCN family.

26.825 kDa

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Wisp2

WNT1-inducible-signaling pathway protein 2

250 amino acids

May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).

Belongs to the CCN family.

27.005 kDa

MRGSPLIRLLATSFLCLLSMVCAQLCRTPCTCPWTPPQCPQGVPLVLDGCGCCKVCARRLTESCEHLHVCEPSQGLVCQPGAGPGGHGAVCLLDEDDGDCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVTLPSWDCPRPKRIQVPGKCCPEWVCDQGVTPAIQRSAAQGHQLSALVTPASADAPWPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLPRPCLAARSHSSWNSAF