Wdr41

WD repeat-containing protein 41

460 amino acids

Non-catalytic component of the C9orf72-SMCR8 complex, a complex that has guanine nucleotide exchange factor (GEF) activity and regulates autophagy. The C9orf72-SMCR8 complex promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB8A and RAB39B into their active GTP-bound form, thereby promoting autophagosome maturation. The C9orf72-SMCR8 complex also acts as a negative regulator of autophagy initiation by interacting with the ATG1/ULK1 kinase complex and inhibiting its protein kinase activity.

51.511 kDa

MLRWLIGGGREPQGLAEKAALQTIGEDQGQNPYTELLVLEAHRDIVRFLVRLDDFRFASAGDDGIIVVWNAQTGEKLLELRGHTQKITAVIAFPPLDSCEASSQLLLTASADRTVGVWDCDTGRQIQRVTCFQSTVKCLTVLQRLDIWLSGGSDLGVWNRKLDLLCKTSHLSDTGISALVEIPGNCVAAAVGRELIIFRLVTPTEELPEWDIIEVKRLLDHQDNILSLANINDTGFVTGSHVGELLIWDALDWTVQACERTFWSPTAQLDAQQEIKLFQKQNDISINHFTCDEENIFAAVGRGLYVYNLQLKRVIACQKTAHDSNILHIDKLPNRQLISCSEDGAVRMWEVREKQQLAAEPVPTGFFNMWGFGRVNKQASQPVKKQEENVTTCSLELIGDLIGHSSSVEMFLYFEDHGLVTCSADHLIILWKNGERESGVRSLKLFQKLEENGDLYPESP

WDR41

WD repeat-containing protein 41

459 amino acids

Non-catalytic component of the C9orf72-SMCR8 complex, a complex that has guanine nucleotide exchange factor (GEF) activity and regulates autophagy (PubMed:27193190, PubMed:27103069, PubMed:27617292, PubMed:28195531). The C9orf72-SMCR8 complex promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB8A and RAB39B into their active GTP-bound form, thereby promoting autophagosome maturation (PubMed:27103069). The C9orf72-SMCR8 complex also acts as a negative regulator of autophagy initiation by interacting with the ATG1/ULK1 kinase complex and inhibiting its protein kinase activity (PubMed:27103069, PubMed:27617292).

51.728 kDa

MLRWLIGGGREPQGLAEKSPLQTIGEEQTQNPYTELLVLKAHHDIVRFLVQLDDYRFASAGDDGIVVVWNAQTGEKLLELNGHTQKITAIITFPSLESCEEKNQLILTASADRTVIVWDGDTTRQVQRISCFQSTVKCLTVLQRLDVWLSGGNDLCVWNRKLDLLCKTSHLSDTGISALVEIPKNCVVAAVGKELIIFRLVAPTEGSLEWDILEVKRLLDHQDNILSLINVNDLSFVTGSHVGELIIWDALDWTMQAYERNFWDPSPQLDTQQEIKLCQKSNDISIHHFTCDEENVFAAVGRGLYVYSLQMKRVIACQKTAHDSNVLHVARLPNRQLISCSEDGSVRIWELREKQQLAAEPVPTGFFNMWGFGRVSKQASQPVKKQQENATSCSLELIGDLIGHSSSVEMFLYFEDHGLVTCSADHLIILWKNGERESGLRSLRLFQKLEENGDLYLAV