WDR18

WD repeat-containing protein 18

432 amino acids

Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (By similarity). Component of the PELP1 complex involved in the nucleolar steps of 28S rRNA maturation and the subsequent nucleoplasmic transit of the pre-60S ribosomal subunit (By similarity).

Belongs to the WD repeat IPI3/WDR18 family.

47.611 kDa

MAAPMEVAVCTDSAAQLWSCVVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYICAWELQRKDQLQQKIMCPGPVTCLTTSPNGLYVLAGISENIYLWEVSTGNLLVILSRHYQDVSCLQFTGDSSHFISGGKDCLVLAWSLCSVLQADPSRTPAPRHVWSRHTLPITDLHCGFGGPLARVATASLDQTVKLWEVSSGELLLSVLFDVGILAVTMDLAEHYMFCGGSDGSIFQVDLCTWPGQREKSFQPEQEHGKVFRGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQSQQCLRTVTLKGPVTNACIMLAPVSMLSSDFRPGLPLPHFNKHLLGAEHGDEPHRGGLMLRLGLHQQGSEPSYLERVEQLQAVMSSTLEKNVLGGQDQLRIRVTELEDEVRNLRKINRDLFDFSTRIITHPTK

WDR18

WD repeat-containing protein 18

432 amino acids

Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed:22872859). Component of the PELP1 complex involved in the nucleolar steps of 28S rRNA maturation and the subsequent nucleoplasmic transit of the pre-60S ribosomal subunit (PubMed:21326211).

Belongs to the WD repeat IPI3/WDR18 family.

47.405 kDa

MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAWELQRKDQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRHYQDVSCLQFTGDSSHFISGGKDCLVLVWSLCSVLQADPSRIPAPRHVWSHHALPITDLHCGFGGPLARVATSSLDQTVKLWEVSSGELLLSVLFDVSIMAVTMDLAEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQSKQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGDEPRHGGLTLRLGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

wdr18

WD repeat-containing protein 18

431 amino acids

Involved in left-right determination through controlling the correct clustering and migration of dorsal forerunner cells (DFCs) and Kupffer's vesicle formation (PubMed:21876750). Component of the PELP1 complex involved in the nucleolar steps of 28S rRNA maturation and the subsequent nucleoplasmic transit of the pre-60S ribosomal subunit (By similarity).

Belongs to the WD repeat IPI3/WDR18 family.

47.155 kDa

MSAPVEVVLSADSAGQLFNCAVYDPHTGSEFLSYRGGNTSSRSLTILNGEYILGAQLGKNYINVWEIQRKDQLQQKIVCPGIVTCLCASPDGLYVLAGIAEAIYLWEVSTGNLLAILSRHFQDLSCIKFTDDSSHFVSGGKDNLAFIWNLSSVVQLDSSRTPEPRHILSRHSLPITDIHCGLMGPQARVATASLDQTVKVWEISSGEMLLSVLFDVGIMSVTFDPCEYFLFCGGSDGNIFQVSLCSTSLSRDKTFQSDSEGNQVFKGHRNLVTCLSVSMDGTVLLSGSNDETVRMWDVQSKQCIWTINHRGPVTNAAIIPAPANMFLSDSHPAVPLPRFSRHLNPSEQGDGTGTGGMSLRLGANTQEPEGTYLEKAEELYSLMCAVTDKSVFGDGENTKVRVSELEEEVRTLKKINKDLYEFSTQLLTKPN

Wdr18

WD repeat-containing protein 18

431 amino acids

Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed:22872859). Component of the PELP1 complex involved in the nucleolar steps of 28S rRNA maturation and the subsequent nucleoplasmic transit of the pre-60S ribosomal subunit (By similarity).

Belongs to the WD repeat IPI3/WDR18 family.

47.211 kDa

MAAPMEVVVCTDAAAQLWSCVVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQQGKNYICAWELQRKDQLQQKIMCPGPVTCLTTAPNGLYVLAGIAESIYLWEVCTGNLLVILSRHYQDVSCLKFTGDGSHFVSAGKDCLALAWSLCSVLQADPSRILAPRHVWSQHTLPITDLHCGFGGPMARVATASLDQTVKLWAISSGDLLLSVLFDMGITSVTMDLAEHHIFCGGSDGSIFQVDLCSWPGLREHSFQPEQNTGKVFKGHRNQVTCLSVSTDGSVLLSGSHDESVRLWDVKSKQCLRTVTLKGPVTNAAIILAPPSMLNPEFRPSLPLPHFNKHLLGAEHGDEAQGGGLRLQLGLHLQGKEPSYLERLEQLQAVLSSYLEKNMLGSQMLPARVFDLEDEVRSLRKINRDLFDFSTRIITRPSK

Wdr18

WD repeat-containing protein 18

431 amino acids

Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (By similarity). Component of the PELP1 complex involved in the nucleolar steps of 28S rRNA maturation and the subsequent nucleoplasmic transit of the pre-60S ribosomal subunit (By similarity).

Belongs to the WD repeat IPI3/WDR18 family.

47.225 kDa

MAAPMEVVVCTDSAAPLWSCMVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQQGKNYICAWELQRKDQLQQKIMCPGPVTCLTTAPNGLYVLAGIAESIYLWEVSTGNLLVILSRHYQDVSCLKFTGDGSHFVSAGKDCLVLAWSLCSVLQADPSRILAPRHVWSQHTLPITDLHCGFGGPMARVATASLDQTMKLWAISSGDLLLSVLFDMGITSVTMDLAEHYIFCGGSDGSIFQVDLCSRPGPREQSFQPEQNTGKVFKGHRNQVTCLSVSTDGSILLSGSHDESVRLWDVKSKQCVRTVPLKGPVTNAAITLAPPSMLNPEFRPSLPLPHFNKHLLGAEHGDEAQGGGLRLQLGLHLQGKEPSYLERLEQLQAALSGYLEKNMLGSQMLPVRVFELEEEVRSLRKINRDLFDFSTRIITRPSK