VTE5

Phytol kinase 1, chloroplastic

304 amino acids

Kinase involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytol monophosphate (PMP) in the presence of CTP or UTP. No activity with ATP or GTP as phosphoryl donor.

Belongs to the polyprenol kinase family.

33.09 kDa

MAATLPLSPINHQLCRFGNNSLTTHRFCSPGFLISSPCFIGLTGMGSATQLRARRSLISSAVATNSLLHDVGATVAVLGGAYALVLSFESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGLSISPNSMLIKSVTREGRAEELLKGPLFYVLALLFSAVFFWRESPIGMISLAMMCGGDGIADIMGRKFGSTKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHMNWETTLQRVAMVSMVATVVESLPITDQLDDNISVPLATILAAYLSFGY

vte5

Phytol kinase

233 amino acids

Catalyzes the CTP-dependent phosphorylation of phytol to phytylmonophosphate (PMP). Can also use UTP as an alternative phosphate donor, but not ATP or GTP. Is involved in tocopherol biosynthesis, via the utilization of phytol generated by chlorophyll degradation (PubMed:16361393). Also plays a significant but not critical role in the recycling of phytol for the biosynthesis of new chlorophyll molecules (PubMed:17499209).

Belongs to the polyprenol kinase family.

24.737 kDa

MGIEQNNPMALPLWIAVGLAATYLGAVVLTAELLNRLSLSPAEVTRKIVHIGAGQVVLIAWWLSIPGWVGAIAGVFAAGIAVLSYRLPILPSLESVGRHSYGTLFYALSIGLLVGGFFSLGLPIFAAIGILVMAWGDGLAALVGQRWGRHRYQVFGFRKSWEGTLTMVLASFLVTVVFLSYTFGFTVIVLVVAGTVAIASAGLESFSRWGIDNLTVPLGSALIAWAGSYLWLG