Vps37d

Vacuolar protein sorting-associated protein 37D

261 amino acids

Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation (By similarity).

Belongs to the VPS37 family.

28.563 kDa

MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLERDACLASNYALAKENLALRPRLEMGRTALAIKYQELREVAENCADKLQRLEKSMHRWSPQCALGWLQAELEEAEQEAEVQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQEVLRRRERSAQPAPTTAAAAAAAATAMDPPKPFPAAAVLPTGAARGPPPAVPRSLPPLDSRPVPPVKGSPGCPFGPAPLLSPRPSQPEPPHR

VPS37D

Vacuolar protein sorting-associated protein 37D

251 amino acids

Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation.

Belongs to the VPS37 family.

27.73 kDa

MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQPAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLSPRPSQPEPPHR