vps26b

Vacuolar protein sorting-associated protein 26B

337 amino acids

Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. Retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) (By similarity).

Belongs to the VPS26 family.

39.194 kDa

MSFFGFGPAAELDIALTDGESRRRVEHKTEDGKKEKYFLFYDGETVSGRVTVNLRNPGKRLEHQGLKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEISQSQSFDFEFTHVEKPYESYTGQNVKLRYFLRATLSRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTSHPETRPQHSGAAAVEQEQE

VPS26B

Vacuolar protein sorting-associated protein 26B

336 amino acids

Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. May be involved in retrograde transport of SORT1 but not of IGF2R. Acts redundantly with VSP26A in SNX-27 mediated endocytic recycling of SLC2A1/GLUT1 (By similarity).

Belongs to the VPS26 family.

39.155 kDa

MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLALKNPNKRLEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ

Vps26b

Vacuolar protein sorting-associated protein 26B

336 amino acids

Acts as component of the retromer cargo-selective complex (CSC) (PubMed:21040701, PubMed:21920005). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5 (By similarity). May be involved in retrograde transport of SORT1 but not of IGF2R (PubMed:21040701). Acts redundantly with VSP26A in SNX-27 mediated endocytic recycling of SLC2A1/GLUT1 (PubMed:25136126).

Belongs to the VPS26 family.

39.125 kDa

MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLSLKNPNKRLEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPGQLSDNNSRQ

VPS26B

Vacuolar protein sorting-associated protein 26B

336 amino acids

Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. May be involved in retrograde transport of SORT1 but not of IGF2R. Acts redundantly with VSP26A in SNX-27 mediated endocytic recycling of SLC2A1/GLUT1 (By similarity).

Belongs to the VPS26 family.

39.109 kDa

MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVGLALKNPNKRLEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENVTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ

vps26b

Vacuolar protein sorting-associated protein 26B

331 amino acids

Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. Retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) (By similarity).

Belongs to the VPS26 family.

38.627 kDa

MSFFGFGQTAEIDIVLNDAETRKKVEHKTEDGKKDKYFLFYDGETVSGKVNVTLKTPGKRLEHYGIKIEFVGQIELYYDRGNHHEFVSLVKDLARPGELSQSQTFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLNDISKEMDIVVQTLCTYPEINSSIKMEVGIEDCLHIEFEYNKSKYHLRDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPSVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYEMTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEITLWRKGDIVRRSMSQQATIAAQRYEGSNPEPTSAQAKEETD

VPS26B

Vacuolar protein sorting-associated protein 26B

303 amino acids

Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.

Belongs to the VPS26 family.

35.204 kDa

MNYLLGAFKPACNISITFSDGKNRKQVPMKKENGQTALVPLFHSQDTISGKVCIEPYQGKKVEHNGVKVELLGQIEMYFDRGNFYDFTSLVRELDVPGEIYERKTYPFEFPTVEMPYETYNGVNVRLRYVLKVTVTRGYAGSILEYQELVVRNYAPLPDINNSIKMEVGIEDCLHIEFEYNKSKYHLKDVILGKIYFLLVRIKMKNMDLEIRRRESTGAGANTHVETETLAKFELMDGTPVRGESIPVRLFLAPYDLTPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITLYRLKEDASS