Vha14

V-type proton ATPase subunit F

127 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase F subunit family.

14.152 kDa

MALLSAMKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSEIEDCFKRFIKRDDIDIILINQNYAELIRHVIDSHTAPTPAVLEIPSKDHPYDASKDSILRRAKGMFNPEDMIANRG

VHA14

V-type proton ATPase subunit F

124 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. V-ATPase is responsible for energizing electrophoretic potassium/proton antiport (1 potassium ion is exchanged for 2 protons) by generating a transmembrane voltage of more than 200 mV.

Belongs to the V-ATPase F subunit family.

13.814 kDa

MALHAAVKGKLISVIGDEDTCVGFLLGGIGEINKNRHPNFMVVDKNTPVSEIEECFKRFVKRDDIDIILINQNVAELVRHVIDAHTAPVPSVLEIPSKDHPYDASKDSILRRAKGMFNPEDLVR

Vha14

V-type proton ATPase subunit F 1

124 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase F subunit family.

13.876 kDa

MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTPVSELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMFNPEDLVR