VHA-E2

V-type proton ATPase subunit E2

235 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase E subunit family.

26.853 kDa

MNDADVSKQIQQMVRFIRQEAEEKANEISISAEEEFNIERLQLLESAKRKLRQDYDRKLKQVDIRKRIDYSTQLNASRIKYLQAQDDVVTAMKDSAAKDLLRVSNDKNNYKKLLKSLIIESLLRLKEPSVLLRCREMDKKVVESVIEDAKRQYAEKAKVGSPKITIDEKVFLPPPPNPKLPDSHDPHCSGGVVLASQDGKIVCENTLDARLDVAFRQKLPQIRTRLVGAPETSRA

VHA-e2

V-type proton ATPase subunit e2

70 amino acids

Subunit of the integral membrane V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase e1/e2 subunit family.

7.685 kDa

MAFVVTSLIFAVVGIIASICTRICFNKGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLIVPILSEVE