About Products Protein Database Contact

VCM66_1188

Gene
VCM66_1188
Protein
UPF0299 membrane protein VCM66_1188
Organism
Vibrio cholerae serotype O1 (strain M66-2)
Length
129 amino acids
Similarity
Belongs to the UPF0299 family.
Mass
13.855 kDa
Sequence
MLILLMIKKIAQYCVSMGLIFLCLLAGINLQTWLGIAIPGSIIGLLILFGLMASGLVPVEWVKPSATLFIRYMILLFVPISVGLMVHFDTLLANLAPILASAIGGTLIVMVTLGLILDRMLKKGKKSCG