VATC

V-type proton ATPase subunit C 2

384 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase C subunit family.

44.105 kDa

MSEFWVISAPGDKTPQQTYERLQKATMGSGQNLSNCYKFSIPELKVGTLDSLIGLTDDLGKLDTFCEGVCRKVASYMGEVLEDQKDKLSSNLSAGEGTLVNFMHRFQWNMAKYPTKQPIKSLTEILSKVVTQVDTDLRSKSQAYNNLKSSLQNMERKATGSLLLRNLSQIVKKDDFIDGSEYLRTVIVAVPVALFGEWEKNYESLADYVAPKSSRLLTQDEEYGLFATSIFKKVYEEFKYNCSRYKFFVREFNFNEQDSVVRQDQINKIASEKRKMLGPLLRWLKVNFSEVFTAWIHIKALRVFVESVLRYGLPVNFQAVVLDPPKKNRKRLRDVLNNLYCKLDSTGLTNVDAEDSVPGLSLGMQEYYPYVFYKVILDFESRSF

vatC

V-type proton ATPase subunit C

368 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase C subunit family.

42.287 kDa

MSETQEFWLISAPNLPGADIFDQVNQKTAKENSLSENKKFNTPALRVGTLNSLITLNDELQKIDTIVESTTKKIARQLVDLVGTKPGKDKSLSINGHTIPQYLQQFAWDDAKYNLKLSLQEIVEKISSAVSKIDDDLKIKSSEYSTLSSSVASEERKASGNLQVRTLNDLITADNIVQTDYFTTAFVVIPKQSEKEFLACYETISDFVLGRSAKRVAQDNDYFLYSVILFKKFYENFKTKIIEKKWVVRDFKLEDNKPTQERSKLTEDKKNCRTSLIRWCRLNFPEAFMAWVHLKVVRVFVESVLRFGIPFNFQAILMKPQKGADKKVRDILFDQFKYLGSAHISGKNETDDSEKFYPYISVSVNWEN

VATC

V-type proton ATPase subunit C

354 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase C subunit family.

39.985 kDa

MATRYWIAALPVADDNVAAGKTALWARLQEAISRHSFDTPLYRFTVPDLRPGTLDSLLALSDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPVDSYLTRFVWDEGKYPVNAPLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIKPEDMVTSEHLVTLLSIVPKYSQKDWLASYESLDTFVVPRSSKKLYEDNEYALYTVTLFAKVVDNFKVHAREKGFQIRDFEYSPEAQESRKQELEKLLQDQEVMRTSPIAMGAMLATVRVFSSWDAFSSAVRVFVESILRYGSACTVPVCCPSTIYKEREKSKEHLGRAMRQYQQLLEI