UBC6

Ubiquitin-conjugating enzyme E2 6

251 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.

Belongs to the ubiquitin-conjugating enzyme family.

28.423 kDa

MASIQANKRLTKEYKNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTFPSDYPFNPPAIRMITPNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMTGDEQTTGSVSTSDKDKRTLAKKSKHFNTYSNFKFKNMFPDLRESNIKDIEREAALEAESKGAQQEENKAQKLATEKATSLDDISDPEDRVRIQELIKAEKDKKDQDKNPGENSNIKSLLCLILAIAIFFVGLIMK

UBC6

Ubiquitin-conjugating enzyme E2 6

250 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.

Belongs to the ubiquitin-conjugating enzyme family.

28.383 kDa

MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSDHQKKTLARNSISYNTFQNVRFKLIFPEVVQENVETLEKRKLDEGDAANTGDETEDPFTKAAKEKVISLEEILDPEDRIRAEQALRQSENNSKKDGKEPNDSSSMVYIGIAIFLFLVGLFMK

UBC6

Ubiquitin-conjugating enzyme E2 6

246 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.

Belongs to the ubiquitin-conjugating enzyme family.

28.4 kDa

MATKQAQKRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAIRMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTGDESTTGSITTTQQEKKILAKKSMYYNTFNSTRFKLVFPEIVEKNITELQRRKQEEKDMSMFEKKEDPLVKAAREKAIEVKDIVNPEDRIRAEQALKELEKQHNDKPNGSSSMFYIGVALFLFLVGLFMK

UBC6

Ubiquitin-conjugating enzyme E2 6

242 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.

Belongs to the ubiquitin-conjugating enzyme family.

27.612 kDa

MASRQAYKRLSKEYKMMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFNPPAIRMLTPNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTTDESSIGTMESTDSTKRKYAAKSKEHNATRSPIFCQIFPELAEQNRRDIEEAKKRKDETVVEDEHPFKQEQVVSLEEINDPEDRIRAQMLQQPAGNGTTSNSIGRSLLFVLFSLAALLVAVCYTRV

UBC6

Ubiquitin-conjugating enzyme E2 6

242 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.

Belongs to the ubiquitin-conjugating enzyme family.

27.282 kDa

MASRQSQKRLTKEYKAITLNPPPYVSAKPNDENILEWHYVITGPPHTPFEEGQYHGILRFPSEYPFKPPSISMITPNGRFACNTRLCLSMSDYHPDTWNPAWSVATILTGLLSFMTGDESTTGSITTSDNVKKRLARSSKEWNNAENQRFTKQFPDLVAQNKVDVAARNAREQAAATTDSTDPEKPFDVRENIDSLDPEDRARLLVEQDDHSTPSFGVQRFTLVGVVVAAFIAAYFNFFSRT

ubc6

Ubiquitin-conjugating enzyme E2 6

227 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the doa10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.

Belongs to the ubiquitin-conjugating enzyme family.

25.659 kDa

MASKGAYKRLMKEYLALQKNPVELVDAKPATENILEWHYIITGPPDTPYEGGQYHGTLIFPPDYPFKPPAIRMITPSGRFQTNTRLCLSFSDFHPKSWNPSWMVSTILVGLVSFMTSDEITTGGIVTSESTRRTYAKDTKRFNIMDNPKFLIMFPELIDKNREDIAKAAAEAALIEPQQIHSTPVSSNECKKNEPFNSKQSWVKSRWSIAVLVFFALALARFFGADS

UBC6

Ubiquitin-conjugating enzyme E2 6

183 amino acids

Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.

Belongs to the ubiquitin-conjugating enzyme family.

20.785 kDa

MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYPYKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCEKYAKPEEILSDDDDDDSMSEDGSDSDDDDDDEIVGKADP

Ubc6

Ubiquitin-conjugating enzyme E2-17 kDa

151 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA (PubMed:1902572). Involved in the negative regulation of the Ras/MAPK signaling pathway in the wing by acting with the putative E3 ligases poe, Kcmf1 and Ufd4 to mediate the ubiquitination and proteasomal degradation of rl/MAPK (PubMed:27552662).

Belongs to the ubiquitin-conjugating enzyme family.

17.152 kDa

MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID