US3

Protein kinase US3 homolog

492 amino acids

Multifunctional serine/threonine kinase that plays a role in several processes including egress of virus particles from the nucleus, modulation of the actin cytoskeleton and inhibition of apoptosis. Phosphorylates UL31 and UL34 homologs, two critical regulators of capsid budding from nucleus to endoplasmic reticulum, thereby facilitating virion egress. Modulates and redistributes host components of the nuclear envelope, including LMNA, emerin/EMD and the nuclear matrix protein MATR3. Phosphorylates envelope glycoprotein B (gB), probably to direct it to the cell surface. Promotes virus intracellular spread by restructuring host cell cytoskeleton. Blocks host apoptosis to extend cell survival and allow efficient viral replication. Promotes viral gene expression by phosphorylating host HDAC2 to reduce viral genome silencing (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

55.381 kDa

MTRKRFLCPSVCRSRAARTGESKRRRLHSHDRRRCAITPDFDEDGRMAHIANPRPNPLECAEASQKVIMAPSRSDTTGAHRCLEDAAPVGELLVPRSSADLHESQRGQPSGATDSQASTLETESAPPSADSSSSAKLQRDDEFLAKYRVIGTLPAGSFGKILVCALRASVGEAEASRVPRSERRVAKRVRATSRLAIYLENEILALQYMNHENILKVEEVLRSEAYTYMITRKYDYDLYSFMYDGDLQWKDRPLLWQTRAIMKQLLCAVEYMHDKLLMHRDIKLENVFLNGDGTIVLGDLGTAMTFEKPRVARDYGWVGTVTTNSPEMLAGDGYCEITDLWSCGLIMLDMLSKDLLPLNGNTKKPGKQLRRIIRSLSVCDEEFPDPPCKLFDYIDSAEYTHTPMSVPPLIRRMGLPADFEYPLVKMLTFDWHRRPGASELLALPLFSSTITEERLFVWGLKSGAAHFSSWKPACRIESDTAALSLTMSDDDE

US3

Serine/threonine-protein kinase US3

481 amino acids

Multifunctional serine/threonine kinase that plays a role in several processes including egress of virus particles from the nucleus, modulation of the actin cytoskeleton and inhibition of apoptosis. Phosphorylates UL31 and UL34, two critical regulators of capsid budding from nucleus to endoplasmic reticulum, thereby facilitating virion egress. Modulates and redistributes host components of the nuclear envelope, including LMNA, emerin/EMD and the nuclear matrix protein MATR3. Phosphorylates envelope glycoprotein B (gB), probably to direct it to the cell surface. Promotes virus intracellular spread by restructuring host cell cytoskeleton. Blocks host apoptosis to extend cell survival and allow efficient viral replication. Promotes viral gene expression by phosphorylating host HDAC2 to reduce viral genome silencing.

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

52.835 kDa

MACRKFCRVYGGQGRRKEEAVPPETKPSRVFPHGPFYTPAEDACLDSPPPETPKPSHTTPPSEAERLCHLQEILAQMYGNQDYPIEDDPSADAADDVDEDAPDDVAYPEEYAEELFLPGDATGPLIGANDHIPPPCGASPPGIRRRSRDEIGATGFTAEELDAMDREAARAISRGGKPPSTMAKLVTGMGFTIHGALTPGSEGCVFDSSHPDYPQRVIVKAGWYTSTSHEARLLRRLDHPAILPLLDLHVVSGVTCLVLPKYQADLYTYLSRRLNPLGRPQIAAVSRQLLSAVDYIHRQGIIHRDIKTENIFINTPEDICLGDFGAACFVQGSRSSPFPYGIAGTIDTNAPEVLAGDPYTTTVDIWSAGLVIFETAVHNASLFSAPRGPKRGPCDSQITRIIRQAQVHVDEFSPHPESRLTSRYRSRAAGNNRPPYTRPAWTRYYKMDIDVEYLVCKALTFDGALRPSAAELLCLPLFQQK

US3

Serine/threonine-protein kinase US3

481 amino acids

Multifunctional serine/threonine kinase that plays a role in several processes including egress of virus particles from the nucleus, modulation of the actin cytoskeleton and inhibition of apoptosis. Phosphorylates UL31 and UL34, two critical regulators of capsid budding from nucleus to endoplasmic reticulum, thereby facilitating virion egress. Modulates and redistributes host components of the nuclear envelope, including LMNA, emerin/EMD and the nuclear matrix protein MATR3. Phosphorylates envelope glycoprotein B (gB), probably to direct it to the cell surface. Promotes virus intracellular spread by restructuring host cell cytoskeleton. Blocks host apoptosis to extend cell survival and allow efficient viral replication. Promotes viral gene expression by phosphorylating host HDAC2 to reduce viral genome silencing (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

52.678 kDa

MACRKFCGVYRRPDKRQEASVPPETNTAPAFPASTFYTPAEDAYLAPGPPETIHPSRPPSPGEAARLCQLQEILAQMHSDEDYPIVDAAGAEEEDEADDDAPDDVAYPEDYAEGRFLSMVSAAPLPGASGHPPVPGRAAPPDVRTCDTGKVGATGFTPEELDTMDREALRAISRGCKPPSTLAKLVTGLGFAIHGALIPGSEGCVFDSSHPNYPHRVIVKAGWYASTSHEARLLRRLNHPAILPLLDLHVVSGVTCLVLPKYHCDLYTYLSKRPSPLGHLQITAVSRQLLSAIDYVHCKGIIHRDIKTENIFINTPENICLGDFGAACFVRGCRSSPFHYGIAGTIDTNAPEVLAGDPYTQVIDIWSAGLVIFETAVHTASLFSAPRDPERRPCDNQIARIIRQAQVHVDEFPTHAESRLTAHYRSRAAGNNRPAWTRPAWTRYYKIHTDVEYLICKALTFDAALRPSAAELLRLPLFHPK

US3

Membrane glycoprotein US3

186 amino acids

Retains, but does not degrade MHC class I heterodimers in the endoplasmic reticulum during the immediate-early period of virus infection, thereby impairing their transport and maturation. Forms a complex with beta-2-microglobulin-associated class I heavy chains, which accumulate in the ER. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.

Belongs to the cytomegalovirus US2 family.

21.574 kDa

MKPVLVLAILAVLFLRLADSVPRPLDVVVSEIRSAHFRVEENQCWFHMGMLYFKGRMSGNFTEKHFVNVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNIGGHPVTHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSMRDDNWGLLFRTLLVYLFSLVVLVLLTVGVSARLRFI

US3

Membrane glycoprotein US3

186 amino acids

Retains, but does not degrade MHC class I heterodimers in the endoplasmic reticulum during the immediate-early period of virus infection, thereby impairing their transport and maturation. Forms a complex with beta-2-microglobulin-associated class I heavy chains, which accumulate in the ER. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.

Belongs to the cytomegalovirus US2 family.

21.556 kDa

MKPVLVLAILAVLFLRLADSVPRPLNVVVSEIKSAHFRVEENQCWFHMGMLYFKGRMSGNFTKKHFVNVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNIGGYPVSHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSMRDDNWGLLFRTLLVYLFSLVVLVLLTVGVSARLRFI

US3

Membrane glycoprotein US3

186 amino acids

Retains, but does not degrade MHC class I heterodimers in the endoplasmic reticulum during the immediate-early period of virus infection, thereby impairing their transport and maturation. Forms a complex with beta-2-microglobulin-associated class I heavy chains, which accumulate in the ER. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.

Belongs to the cytomegalovirus US2 family.

21.515 kDa

MKPVLVLAILAVLFLRLADSVPRPLDVVVSEIRSAHFRVEENQCWFHMGMLHYKGRMSGNFTEKHFVSVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNIGGHPVPHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSIRDDNWGLLFRTLLVYLFSLVVLVLLTVGVSARLRFI