UL20

Uncharacterized protein UL20

340 amino acids

Belongs to the HHV-5 UL20 protein family.

38.702 kDa

MLGIRAMLVMLDYYWIQLITNNDTRSNNTDTIFVSLLTGANGVTRTAIGGLHSNYTNLTEAFRFTPANTTTNSSTEGNWSVTNLTESCINRGESYLTTIWLLNCADNNTYWYSGNAYNHTIDTCKNTVSGYLFFGMCQLWKDWVTNASHDTVRIQSLGNEIRCMLLPRQYTLNATVEWYNKSEGDVPEEFMDYVILTPLAVLTCGLQEAYILDKGRRYMYLFSVSCAGITGTVSIILVSLSLLILICYYRCGRLLICPRGFELLPEFTEEEEEKEKLLTYKDIEVQVPIRTRRLLVPWIRESKMWVLPPPLPPRPPHLIEFPPSPPPSPGPMHMVVCMPA

UL20

Membrane protein UL20

338 amino acids

Belongs to the HHV-5 UL20 protein family.

38.33 kDa

MLGIRAMLVMLDYYWIQLITNNGTRSNNTDTIFVSLLTGPNGVTRTAIGGLYSNYTNLTGAFGFTSTNMSATNSSAEDNWSVTNLTESCINRGESYVTTIWLLDCTKNDTYWYYGNAYNHTCEGTISGYLLGMCKLWKSWVNNITSYNTVRVESLGNETRCMLLPRQYTLNATVEWYNKSEGDVPEEFMDYVILTPLAVLTCGLQEAYILDKGRRYMYLFSVSCVGITGTVSIILVSLSLLILICYYRCGRLLICPRGFELLPEFTEEEEEKEKLLTHNDIEVQVPIRTRRLLVPWIRESKMWVLPPPLPPRPPHLIEFPPSPPPSPGPMHMVVCMPA

UL20

Protein UL20

248 amino acids

Plays an essential role in egress of virus particles from the nucleus, cytoplasmic envelopment and virus-induced cell fusion. Forms a functional protein complex with gK and this interaction is absolutely essential for their coordinate intracellular transport, gK glycosylation, expression on host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress and therefore actively participate in these processes (By similarity).

Belongs to the alphaherpesvirinae UL20 family.

26.6 kDa

MADASAPDKKNAPTNALKPDLIKIAVERVLAAIDTENNEDLILAAAREPREVVAARAPDLFTSAAYSWSEEDELGTRMRASSFFPVASMFAKIICCLFLLWAKSCTGHGAMVTGLTACTGAYAIASLLCSFVVYYNVRTDNMPFGTYTKLFQIAACIGCGCYALGLTMEKLFGDSEMYFALFPDAKNSPLVGATAKGSALILPQGCSVAPYVPLAVSVAYCAAVVYDIADTIFPLLWVRTTLNEFAVF

UL20

Protein UL20

222 amino acids

Plays an essential role in egress of virus particles from the nucleus, cytoplasmic envelopment and virus-induced cell fusion. Forms a functional protein complex with gK and this interaction is absolutely essential for their coordinate intracellular transport, gK glycosylation, expression on host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress and therefore actively participate in these processes.

Belongs to the alphaherpesvirinae UL20 family.

24.231 kDa

MTMRDDLPLVDRDLVDEAAFGGEEGELPLEEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKRVILFLWSFLVLKPLEMVAAGMYYGLTGRVVAPACILAAIVGYYVTWAVRALLLYVNIKRDRLPLSAPVFWGMSVFLGGTALCALFAAAHETFSPDGLFHFIATNQMLPPTDPLRTRALGIACAAGASMWVAAADSFAASANFFLARFWTRAILNAPVAF

UL20

Protein UL20

222 amino acids

Plays an essential role in egress of virus particles from the nucleus, cytoplasmic envelopment and virus-induced cell fusion. Forms a functional protein complex with gK and this interaction is absolutely essential for their coordinate intracellular transport, gK glycosylation, expression on host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress and therefore actively participate in these processes (By similarity).

Belongs to the alphaherpesvirinae UL20 family.

24.263 kDa

MTMRDDVPLLDRELVDEAACGGEDGELPLDEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKRVVMFAWSFLVLKPLELVAAGMYYGWTGRAVAPACIIAAVLAYYVTWLARALLLYVNIKRDRLPLSPPVFWGLCVIMGGAALCALVAAAHETFSPDGLFHWITASQLLPRTDPLRARSLGIACAAGAAMWVAAADCFAAFTNFFLARFWTRAILKAPVAF