UHRF1

E3 ubiquitin-protein ligase UHRF1

793 amino acids

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. It is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo. May be involved in DNA repair.

89.814 kDa

MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR

UHRF1

E3 ubiquitin-protein ligase UHRF1

786 amino acids

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. It is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo. May be involved in DNA repair (By similarity).

88.339 kDa

MWIQVRTMDGKVAHTVDSLSRLTKVEELRKKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYDVRLNDTIQLLVRQSLVLPVPVPSSSGGSKERDSELSDTDSGCGLAQSESDKSSNSGEAANEPEGKADEDECDETELGLYKVGEYVDARDTNMGAWFEAKVIRVTRKAPAHDQPSSSSSKPEDDIIYHVTYDDYPENGVVQMTSQNVRARARHTIKWEDLQVGQVVMVNYNPDLPKDRGFWYDAEILRKRETRTARELHANVRIGGDSLNDCRIVFVDEVFKIERPGEGNPMVENPMRRKSGPSCKHCKDDERKLCRMCACHVCGGKQDPDKQLMCDECDMAFHIYCLRPPLSSVPPEEEWYCPDCRIDSSEVVQAGEKLKESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHFGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNHGAYSLVLAGGYEDDVDHGNSFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDLKGAEAKDWRSGKPVRVVRNVKGRKHSKYAPIEGNRYDGIYKVVRYWPEKGKSGFLVWRFLLRRDDVEPGPWTKEGKDRIKKLGLTMQYPEGYLEALARKEKENSKQAALDKEEEDGEEGFTSPRKGKRKSKSAGGDGSSRGTPKKTKVEPYSLTTQQSSLIKEDKSNMKLWTEILKSLKDGPKFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFKAQVFSCPACRYDLGRSYAMTVNQPLQAVLSQLFPGYGSGR

Uhrf1

E3 ubiquitin-protein ligase UHRF1

782 amino acids

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. It is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo. May be involved in DNA repair.

88.304 kDa

MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFDYDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDKTVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPALRNTGKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLTSVPPEPEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYLEALANKEKSRKRPAKALEQGPSSSKTGKSKQKSTGPTLSSPRASKKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGPYQIFLSKVKEAFQCICCQELVFRPVTTVCQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGSGR

uhrf1

E3 ubiquitin-protein ligase UHRF1

776 amino acids

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits dnmt1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins. However, it is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo (By similarity). Required for pregastrula and lens development.

87.091 kDa

MWIQVRTMDGKETHRVDSLSKLTKVDELRVKIAELFNVEPERQRLFYRGKQMEDGHTIFDYNVGLNDIVQLLVRQAVAATVLPKDKEAELSDSDSGCGSAQSESDKGSTHGESDVQSAGASGQTDTADLIDPGFGFYKINEFVDARDLNMGAWFEAQIVKVTKTPAEDGGAEDIVYHVKYEDYPENGVVQLRGKDVRPRARTVYQWHQLEPGMIVMVNYNPDDPKERGYWYDAEIQRKRETRTQREVFGKILLGDAGDSLNDCRIMFVTEIYKIEEPGSAEGPGASSDSPLKKGSNGPECKVCKDDPKKNCRVCNCHVCGIKQDPDKQLLCDECDMAFHTYCLNPPLTTIPDDEDWYCPDCRNDASEVVLAGEKLKESKKKAKMASASSSSQRDWGKGMACVGRTKQCTIVPSNHYGPVPGVPVGTLWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDDGNEFTYTGSGGRDLSGNKRTAEQSCDQKLTNMNRALALNCNAAVNDKEGAEAKDWKAGKPVRVVRSSKGRKHSKYSPEDGNRYDGIYKVVKYWPEKGKSGFLVWRYLLKRNDEESAPWTRDGKERIKKLGLTMQYPEGYLEAVAAKEKEKENKNEDDIEETPTKGKRKRKSQSMEEKSSPTKGTPKKMKVEAYKLSKEQKALIKDDELNKKLWDEAMESLSLGPRFVNKVEEVFLCICCQEVVYQPITTECQHNVCRECLQRSFKAKVYTCPACRHDLGKNYQMAVNKPLQAILTQLFPGYSSGRC

uhrf1

E3 ubiquitin-protein ligase UHRF1

775 amino acids

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits dnmt1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins. However, it is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo.

86.99 kDa

MWIQVRTMDGRDTRRIDSLSKLTKVEDLRARIQQIFGVALESQRLFYRGKQMENGHTLFDYSVGLNDIVQLLVRQIPDSVPTKDKECGISDADSGCGSGQGESDKNSSCGEGATDVDGQPAGINSENVGPSLYKKNDLVDARDLNMGAWFEAQIVSVSKRVNPDGMSAEILDTSAASDDIIYHVKYEDYPENGVVQLTYKDVRLRARTTLPWHDLKVGQVVMVNYNPDEPKERGYWYDAEILRKRETRTIKEIYVKVLLGDAGDSLNDCRIRFVDEIYKIEEPGSAYITTESPQKRQNGPECKHCKDNPKRACRMCACYVCGGKQDPEKQLLCDECDMAFHIYCLKPPLSAIPQDEDWYCPDCRNDASEVVLAGEKLKESKKKAKMASASSSSQRDWGKGMACVGRSRECTIVPSNHYGPIPGVPVGTLWKFRVQVSESGVHRPHVAGIHGRSNDGSYSLVLAGGYEDDVDNGSEFTYTGSGGRDLSGNKRTAEQSCDQKLTNMNRALALNCSAPINDKEGAVAKDWRAGKPVRVVRNTKGKKHSKYAPEDGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDEEPAPWSKEGKERIKKLGLVMQYPDGYLESLASKEREKENKTEDELSESPSKGKRKRNSAGSGLSDAKSTPKKTKVESYKLSLDQKTLIKQDDLNAKLWREVMSFLKEGPKFLSKVEETFLCICCQEVVYEPITTECHHNICKGCLDRSFKALVHNCPACRHDLGKNYSLNVNKPLQAILSQLFPGYERGR

Uhrf1

E3 ubiquitin-protein ligase UHRF1

774 amino acids

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. It is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo. May be involved in DNA repair (By similarity).

87.449 kDa

MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEELFHVEPQLQRLFYRGKQMEDGHTLFDYDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGTADGDDKTVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKKALSEEEPCSSSAIMAPEDDIMYHIKYDDYPEHGVDIVKAKNVRARARTVIPWEDLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQTRTARELYGNVMLLNDSQLNNCRIIFVDEVLKIELPNERSPLIGSPSRRKSGPSCQYCKDDENKPCRKCACHICGGREAPEKQVLCDECDMAFHLYCLQPPLTCVPPEPEWYCPSCRTDSSEVVQAGEKLKKSKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNFFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPEKGKSGFIVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYLEALANKEKNRKRPAKALEQGPSSSKIGKSKRKSTGPATTSPRVSKKSKLEPYTLPLQQANLIKEDKGNAKLWDDVLSSLQDGPYQIFLSKVKEAFQCICCQELVFRPVTTVCQHNVCKDCLDRSFRAQVFSCPACRYDLDHSSPTRVNQPLQTILNQLFPGYGSGR

uhrf1

E3 ubiquitin-protein ligase UHRF1

772 amino acids

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits dnmt1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins. However, it is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo.

86.974 kDa

MWIQVRTMDGRDTRRIDSLSKLTKVDDLRDRIQQLFGVALESQRLFYRGKQMENGHTLFDYSVGLNDIVQLLVRQIPDSFPTKHKECELSDASAGCGSGQRDSDSGSGEGAMDVDGQSISIIGENVGTSLYKKNDLVDARDLNMGAWFEAQIVNVSKKVGPYGTLPEVSDTSVTSDAIIYHVKYEDYPENGVVQLTCKDVRLRARTTLPWHEIKVGQVVMVNYNPDEPKERGYWYDAEILRKHESKKIKEIYAKVLLGDAGDSLNDCRIRFVNEIYKIEEPGSTYLNTESPQKRQNGPECKHCKDNPKRACRMCACCICGGKQDPEKQLLCDECDLAFHIYCLKPPLSVIPQDEDWYCPDCRNDASEVVLAGEKLKESKKKARMASANSSSQRDWGKGMACVGRSRECTIVPSNHYGPIPGVPVGTLWKFRVQVSESGVHRPHVAGIHGRSNDGSYSLVLAGGYEDDVDNGNEFTYTGSGGRDLSGNKRTAEQSCDQKLSNMNRALALNCSAPINDKEGSIAKDWRAGKPVRVVRNSKGRKHSKYAPEEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDYEPAPWSKEGKERIKKLGLTMQYPDGYLETLASKEREKENKTEDEPIDSPSKGKRKRNSDNEQTAAKSIPKKMKVASYKLTLEQKTLIKQDVLNAKLWSEVMLFLKEGPKFVNKVEETFLCICCQEVVYEPVTTECHHNICKGCLDRSFKALVHSCPACRHDLGKNYPLNVNKPLQAILSQLFPGYESGR