ufm1

Ubiquitin-fold modifier 1

100 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

10.63 kDa

MSKVTFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGGRGVGTDRPSSSSSKTQ

ufm1

Ubiquitin-fold modifier 1

91 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

9.785 kDa

MSKVTFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGGRGLYLSP

ufm1

Ubiquitin-fold modifier 1

90 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

9.675 kDa

MSKVTFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATGAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGGGHQPRM

Ufm1

Ubiquitin-fold modifier 1

87 amino acids

Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer (By similarity). The so-called ufmylation, requires the UFM1-activating E1 enzyme Uba5, the UFM1-conjugating E2 enzyme Ufc1, and the UFM1-ligase E3 enzyme Ufl1 (By similarity). This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes (By similarity). The Ufm1 cascade might play a role in the development of the neuromuscular junctions (PubMed:26872069).

Belongs to the UFM1 family.

9.438 kDa

MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAIITDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLS

UFM1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer. The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes. TRIP4 ufmylation may for instance play a role in nuclear receptors-mediated transcription. Other substrates may include DDRGK1 with which it may play a role in the cellular response to endoplasmic reticulum stress.

Belongs to the UFM1 family.

9.168 kDa

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGHC

Ufm1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer. The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes. TRIP4 ufmylation may for instance play a role in nuclear receptors-mediated transcription. Other substrates may include DDRGK1 with which it may play a role in the cellular response to endoplasmic reticulum stress.

Belongs to the UFM1 family.

9.118 kDa

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRLIPRDRVGSC

ufm1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

9.175 kDa

MSKVTFKITLTSDPRLPYKVLCVPENTPFTAVLKFAAEEFKVPAATSAIITNDGIGLNPAQTAGNVFLKHGSELRLIPRDRVGSC

ufm1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

9.175 kDa

MSKVTFKITLTSDPRLPYKVLCVPENTPFTAVLKFAAEEFKVPAATSAIITNDGIGLNPAQTAGNVFLKHGSELRLIPRDRVGSC

UFM1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

9.087 kDa

MSKVTFKVTLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSDLRIIPRDRVGSS

UFM1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

9.057 kDa

MSKVTFKVTLTSDPRLPYKVLSVPEGTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSDLRLIPRDRVGSS

ufm1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached to substrate proteins as a monomer or a lysine-linked polymer in a post-translational process called ufmylation. Ufmylation on lysine residues of proteins may play a crucial role in a number of cellular processes.

Belongs to the UFM1 family.

9.365 kDa

MSKVTFKITLTSDPKLPFRVINVTEDTPFTAVLRFACEQFNVPWQTSAIITNDGIGINPAQTSGNIFLKNGSDLRLIPRDRVGGL

UFM1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer (PubMed:15071506, PubMed:20018847, PubMed:29868776). The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1 (PubMed:15071506, PubMed:20018847, PubMed:29868776). This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes (PubMed:15071506, PubMed:20018847). TRIP4 ufmylation may for instance play a role in nuclear receptors-mediated transcription (PubMed:25219498). Other substrates may include DDRGK1 with which it may play a role in the cellular response to endoplasmic reticulum stress (Probable).

Belongs to the UFM1 family.

9.118 kDa

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC

UFM1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer. The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes. TRIP4 ufmylation may for instance play a role in nuclear receptors-mediated transcription. Other substrates may include DDRGK1 with which it may play a role in the cellular response to endoplasmic reticulum stress.

Belongs to the UFM1 family.

9.118 kDa

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC

Ufm1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer (PubMed:21494687). The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes. TRIP4 ufmylation may for instance play a role in nuclear receptors-mediated transcription (By similarity). Other substrates may include DDRGK1 with which it may play a role in the cellular response to endoplasmic reticulum stress.

Belongs to the UFM1 family.

9.118 kDa

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC

UFM1

Ubiquitin-fold modifier 1

85 amino acids

Ubiquitin-like modifier which can be covalently attached via an isopeptide bond to substrate proteins as a monomer or a lysine-linked polymer. The so-called ufmylation, requires the UFM1-activating E1 enzyme UBA5, the UFM1-conjugating E2 enzyme UFC1, and the UFM1-ligase E3 enzyme UFL1. This post-translational modification on lysine residues of proteins may play a crucial role in a number of cellular processes. TRIP4 ufmylation may for instance play a role in nuclear receptors-mediated transcription. Other substrates may include DDRGK1 with which it may play a role in the cellular response to endoplasmic reticulum stress.

Belongs to the UFM1 family.

9.118 kDa

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC