UCN

Urocortin

124 amino acids

Acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH) (PubMed:8612563). Binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta (PubMed:8612563). Plays a role in the establishment of normal hearing thresholds (By similarity). Reduces food intake and regulates ghrelin levels in gastric body and plasma (By similarity).

Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.

13.458 kDa

MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK

Ucn

Urocortin

122 amino acids

Acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH) (By similarity). Binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta (By similarity). Plays a role in the establishment of normal hearing thresholds (PubMed:12091910). Reduces food intake and regulates ghrelin levels in gastric body and plasma (By similarity).

Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.

13.558 kDa

MIQRGRATLLVALLLLAQLRPESSQWSPAAAAATGVQDPNLRWSPGVRNQGGGVRALLLLLAERFPRRAGSEPAGERQRRDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK

Ucn

Urocortin

122 amino acids

Acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH) (PubMed:7477349). Binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta (By similarity). Plays a role in the establishment of normal hearing thresholds (By similarity). Reduces food intake and regulates ghrelin levels in gastric body and plasma (PubMed:21540451).

Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.

13.711 kDa

MRQRGRATLLVALLLLVQLRPESSQWSPAAAAANVVQDPNLRWNPGVRNQGGGVRALLLLLAERFPRRAGSEPAGERQRRDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK