UBE2F

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.133 kDa

MLTLASKLKRDDGLKGSRASATASDSTRRVSVRDRLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTRIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVEDYIKRYAR

UBE2F

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.229 kDa

MLTLASKLKRDDGVRGPRASNPASDSTRRVSVRDKLLVKEVAELEANLPCTCKVNFPDPNKLHYFQLTVIPDEGYYQGGKFQFEIEVPDAYNMVPPKVKCLTRIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVEDYIKRYAR

ube2f

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the uba3-nae1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase rbx2, but not rbx1, suggests that the rbx2-ube2f complex neddylates specific target proteins, such as cul5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.019 kDa

MLTLASKLKREEGVRAGRTPAGSNDAAHRVSIRDRLLIKEVAELEANLPSTCKVTFPDENKLCHFQLAISPDEGYYLGGKFQFEIEVPEAYNMVPPKVKCLTRIWHPNIAETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIDAAEHHLRDKEDFRNKVQDFIKNYAR

UBE2F

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.077 kDa

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

Ube2f

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.08 kDa

MLTLASKLKRDDGLKGSRASASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYIKRYAR

ube2f

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the uba3-nae1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase rbx2, but not rbx1, suggests that the rbx2-ube2f complex neddylates specific target proteins, such as cul5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.397 kDa

MLTLASKLKRDDGVKGSRTTSTTLDSMRRISVRDRLLVKEVAELEANLPCTCKVNFPDPNKLHYFHLTVSPDESYYQGGRFQFEIEVPDAYNMVPPKVKCLTRIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKDEYRNKVEDYIKRYAR

ube2f

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the uba3-nae1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase rbx2, but not rbx1, suggests that the rbx2-ube2f complex neddylates specific target proteins, such as cul5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.313 kDa

MLTLASKLKRDDGVKGSRTSSTTSDSTRRVSVRDRLLVKEVAELEANLPCTCKVNFPDPNKLHYFHLTVSPDESYYQGGRFQFEIEVPDAYNMVPPKVKCLTRIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKDEYRNKVEDYIKRYAR

Ube2f

NEDD8-conjugating enzyme UBE2F

185 amino acids

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.

21.11 kDa

MLTLASKLKRDDGLKGSRTSASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYIKRYAR