UBE2D4

Ubiquitin-conjugating enzyme E2 D4

147 amino acids

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.

Belongs to the ubiquitin-conjugating enzyme family.

16.649 kDa

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

ube2d4

Ubiquitin-conjugating enzyme E2 D4

147 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Regulates pronephros development, possibly by promoting ubiquitination and thus inactivation or degradation of map3k10/mlk2.

Belongs to the ubiquitin-conjugating enzyme family.

16.677 kDa

MALKRIQKELMDLQRDPPAQCSAGPVGEDLFHWQATIMGPNDSPFQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM