UBE2C

Ubiquitin-conjugating enzyme E2 C

179 amino acids

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

19.608 kDa

MASQNRDPVAASVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVSSQDP

UBE2C

Ubiquitin-conjugating enzyme E2 C

179 amino acids

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

19.652 kDa

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

UBE2C

Ubiquitin-conjugating enzyme E2 C

179 amino acids

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

19.668 kDa

MASQNRDPAATSVTAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Ube2c

Ubiquitin-conjugating enzyme E2 C

179 amino acids

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

19.606 kDa

MASQNRDPAAASVAAVRKGAEPCGGAARGPVGKRLQQELMILMTSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVSSQDP

ube2c

Ubiquitin-conjugating enzyme E2 C

179 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

19.897 kDa

MASQNVDPAAASSVASRKGQESGTSAARGSVGKRLQQELMTLMMSGDKGISAFPESDNLFKWIGTIDGAVGTVYEDLRYKLSLEFPSGYPYNAPTVKFVTPCFHPNVDSHGNICLDILKDKWSALYDVRTILLSLQSLLGEPNNESPLNPYAAELWQNQTAYKKHLHEQYQKQVREKEI

UBE2C

Ubiquitin-conjugating enzyme E2 C

177 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that is essential for the transition from metaphase to anaphase in mitosis. Involved in both degradation of proteins responsible for maintaining sister chromatid cohesion at the onset of anaphase and of mitotic cyclins A and B at the exit of mitosis. Acts by initiating polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

20.134 kDa

MSGQNIDPAANQVRQKERPRDMTTSKERHSVSKRLQQELRTLLMSGDPGITAFPDGDNLFKWVATLDGPKDTVYESLKYKLTLEFPSDYPYKPPVVKFTTPCWHPNVDQSGNICLDILKENWTASYDVRTILLSLQSLLGEPNNASPLNAQAADMWSNQTEYKKVLHEKYKTAQSDK

ube2c

Probable ubiquitin-conjugating enzyme E2 C

153 amino acids

Catalyzes the covalent attachment of ubiquitin to other proteins. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Belongs to the ubiquitin-conjugating enzyme family.

17.473 kDa

MSQDHSVSKRLQSELMNLMMGPSPGISAFPDGDNIFNWIGTIQGAKDTVYEQMEFKMSLKFPTDYPYKPPTVKFETQCFHPNVDNNGNICLDILKDKWSPVYNVRSLLISIQSLLGEPNNESPLNSYAASLWSNQDEYKKVLDKRYQEATSRP