U65

Cytoplasmic envelopment protein 2

335 amino acids

Plays a critical role in cytoplasmic virus egress. Participates in the final step of tegumentation and envelope acquisition within the host cytoplasm by directly interacting with the capsid. Upon virion binding to target cell, a signaling cascade is triggered to disrupt the interaction with the capsid, thereby preparing capsid uncoating.

Belongs to the herpesviridae cytoplasmic envelopment protein 2 family.

37.877 kDa

MAISTFSIGDLGYLRNFLQNECNWFRICKKTFYREYRSVATSSPTFSLNNKPKKFCMHCEIVIFKRSEEFMFSLAVNGIHFGQFLTGKMKFNKKAVPEGLYYYILELGSITPIDLGFIPRYNSDCVTNMRCVTPEVIYENCSIVCPEEANRLTVKGSGDNKLTPLGGCGAWCLKNGGDLYIYTFALAYDLFLTCYDKSTFPSLAKIIFDMIACESEDCVFCKDHNKHVSQAGQIVGCVSNQETCFCYTSCKKKMANINNPELISLLCDQEINKIDIMYPKIKASLSLDINSYAHGYFGDDPYALKCVNWIPVRISAALSRLIVLSCPVCKRVVMD

U65

Cytoplasmic envelopment protein 2

335 amino acids

Plays a critical role in cytoplasmic virus egress. Participates in the final step of tegumentation and envelope acquisition within the host cytoplasm by directly interacting with the capsid. Upon virion binding to target cell, a signaling cascade is triggered to disrupt the interaction with the capsid, thereby preparing capsid uncoating.

Belongs to the herpesviridae cytoplasmic envelopment protein 2 family.

37.878 kDa

MAISTFSIGDLGYLRNFLQNECNWFRICKKTFYREYRSVATSSPIFSLKNKPKKYCMHCEMVVLKRSHEFMFSLAVNGIHFGQFLTGIMKFKKKQVAEGLCYYVLELGSISPVDLSFIPKYNSDCVTSMHCVTPELIYENCSIVCPEEASRLTVKGLGDNKLIPLGGCGVWCLKNGGDLYIYAFVLAYDLYVACYDKTIFPSLAKIVFDMIACDSEDCVFCKDHNKHVSQAGHIVGCVSNQETCFCYTPCQKKMTDINNPELISLLCDQEINKIDIMYPEKKASLSLDINSYVHGYLGDEPCALKCVNWMPIRISSALSRLIILSCPVCKRVVMD

U65

Cytoplasmic envelopment protein 2

330 amino acids

Plays a critical role in cytoplasmic virus egress. Participates in the final step of tegumentation and envelope acquisition within the host cytoplasm by directly interacting with the capsid. Upon virion binding to target cell, a signaling cascade is triggered to disrupt the interaction with the capsid, thereby preparing capsid uncoating.

Belongs to the herpesviridae cytoplasmic envelopment protein 2 family.

37.498 kDa

MNFSSIGNLGCLRSFLQNECNWFSVCKKKLYHEYRCVATSSPVFAVDKFKDCLHCNIIILKKNLDFVFSLAINGIHAGQFATNSIKLKKIIITNDLVYYILELGSLTVTDLHFIPKYNSEHVLNVRPITPNLIYDTCSIVSYDEAKLLTVKGPGENKLIPLGCGSWCLNNMGRYYVYTFVLVYDLYLACFEKNTLPSLSKVVFDMISCNNKHCVFCKDHSKHVEQTGKTVGCTDNQETCFCYTPCKKKMAKISNQDLSSLLCDQELDLLDLIYPEKPTSLSTDINAYVHGHKNQEPVVLRNTNWILIRLDPAISRLILLSCPVCKRIVSR