Protein
Tissue inhibitor of metalloproteinase
Organism
Drosophila melanogaster
Function
Metalloproteinase inhibitor that acts on both matrix metalloproteinases Mmp1 and Mmp2 in vitro (PubMed:14567681). Complexes with metalloproteinases and irreversibly inactivates them by binding to their catalytic zinc cofactor (By similarity). Required for wing maturation which is the final step in morphogenesis of the adult fly (PubMed:16962574). Involved in the negative regulation of developmental tissue invasion for imaginal disk eversion during metamorphosis by inhibiting Mmp-mediated basement membrane (BM) degradation (PubMed:17301221). Required for oogenesis and for the long-term maintainance of germarial structure and shape in the adult ovaries. Required for maintaining composition and biophysical properties of the extracellular matrix (ECM), and for the normal organization and cyst production of the germline stem cell (GSC) niche (PubMed:26808525).
Similarity
Belongs to the protease inhibitor I35 (TIMP) family.
Sequence
MDLRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYKVHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKVYIVAGRMPTLNICSYYKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSPFGKCETNYSACMPHKVQTVNGVISRCRWRRTQLYRKCMSNP