Tim9a

Mitochondrial import inner membrane translocase subunit Tim9

95 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

11.098 kDa

MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKL