TYW3

tRNA wybutosine-synthesizing protein 3

273 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Probably methylates N-4 position of wybutosine-86 to produce wybutosine-72.

Belongs to the TYW3 family.

30.806 kDa

MAAQNAFEQKKRAILNEIDSTQPDLSPKGTIDELCLPIIDLINASADMVTTSSCSGRVSVFLEGTKSYNGEVKIGGKGQGGKWLYVTHDREKVIGWLDELKSKSEFSFELSGKEIPTEKVTGSIRYILYKYEPFILHVKCRDFQAASKLYNTAMSCGFRESGIGSNNLVAIRINIKLDVPLGYLDETSGTLKFFVTPEYVSVLDSLSLSKFDENTRKMQALYDRIEKELINCAPDVNSKVNITPIETKEERRERKKREGMERQRQLKSPQNVL

TYW3

tRNA wybutosine-synthesizing protein 3 homolog

259 amino acids

Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity).

Belongs to the TYW3 family.

29.794 kDa

MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKEKNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY

TYW3

tRNA wybutosine-synthesizing protein 3 homolog

259 amino acids

Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity).

Belongs to the TYW3 family.

29.48 kDa

MDRRAEFKRWKAQCLSKADFSRKGCVDEDVVEIVQLLNGREQFFTTSSCAGRIILLEQGMDSLEVQKQNCCWLLVSHKPCVKDDVIVALKKANGDAILKFEPLVLHVQCRQLQDAQILHSVAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSHKGKLMVTEEYIDFLLKIANHKMEENKKRIERFYNCLQLALEKETTTTNSHPKEKIKEKNNSYKKKSNPGKAHDKCVTEENDKVLENDDDDDPGISVTIFPEDY

TYW3

tRNA wybutosine-synthesizing protein 3 homolog

258 amino acids

Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity).

Belongs to the TYW3 family.

29.303 kDa

MDLSAEFKRWKAQCLSKADLSRKGSVDEDVLEIVQLLNGQEQFFTTSSCAGRIILLDRSVNGSEVQKQNCCWLLVTHKACVKDDVIVALQKAKGDAILKFEPLVLHVQCRQLQDAQILHSVAIDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSHQGKLMVTEEYINFLLKIANQKMEENKKRIERFYHCLQHALEKETVSTTSQPKEKVNTSYIRKKKRNPGKARGKRVNEEHDKELENNDHDDPGISDTIFPEDY

TYW3

tRNA wybutosine-synthesizing protein 3 homolog

258 amino acids

Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity).

Belongs to the TYW3 family.

29.422 kDa

MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDGGINGFEVQKQNCCWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSVAIDAGFRNSGITVGKRGKTMLAVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKEKNNSSYTHKKKNPEKACAQCITKENDKELENDDDDDLGINVTIFPEDY

Tyw3

tRNA wybutosine-synthesizing protein 3 homolog

257 amino acids

Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity).

Belongs to the TYW3 family.

28.575 kDa

MDRSAEFGRWKAQSLSKADLSRKGSVDEDAVEVVELLNSREEFFTTSSCAGRILLLDGSTEGSGVQKQHCCWLLVTHKPCARDDVMAALKGATSEAVLKFEPFILHVQCRTLQDAQTLHSVAIDSGFRNSGITVGKRGKTMLAVRGTHGLEVPLTHKGKLMVTEEYIEFLLTIANQKMEENKRRIGRFYNYLQHALKRETISNSHSKIKERNNPLCTHKNRRSQGKAQGPSTTEDNGRELEDGDGLEISAALFLGDD

tyw3

tRNA wybutosine-synthesizing protein 3 homolog

251 amino acids

Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity).

Belongs to the TYW3 family.

28.798 kDa

MDGDSFQQWKNQCLNKCDFSKKGSVDEDISHVVSFINSQDRYFTTSSCSGRIILFDAVSDCPDVQKQNCSWLFVTHQKCQMEDVVRGLEKSVGDATFKFEPFVLHVQCKQLEDAQLLHTVAINSGFRNSGITVGKKGKIIMAVRSTHCLEVPLSHRSHVLVTHQYLDFLVGVANQKMEENLKRIQRFSECLQAALQPQEEKCSFKEADNKTVYRRRRKRTQDVSVTDSSQNTQEHHENTEEEIDCDLLFLL

tyw3

tRNA wybutosine-synthesizing protein 3 homolog

251 amino acids

Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA (By similarity).

Belongs to the TYW3 family.

28.693 kDa

MEKQEAFSHWKQQSARKTDVSKKGSVDEDIEETVRLINQQERYFTTSSCSGRVIIINETLDNSTIQKQNCSWLFVTHKLCKPDDVFAALQNATGDVVLKFEPFVLHVQCRALEDAQLLHSVAINAGFRNSGITVGKKGKIIMAVRSTHGLEVPLTQNGKCLVSHEYIEFLVHTANKKMEENKRRITRFHSCLHKALQKEDCVHDKTSKEQASSCVYVRRRKRKDRSRKSNCSSSEEEHTDSEPELTLFNDP

tyw3

tRNA wybutosine-synthesizing protein 3

237 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Probably methylates N-4 position of wybutosine-86 to produce wybutosine-72 (By similarity).

Belongs to the TYW3 family.

26.997 kDa

MNIKGIDVSFDAQKKEILEGLKSSVPDASPKGHPDSPIFPLLDVINSHPDWVTTSSCSGRISVYVQGANSRKGGGYWLFVSHQAHEELPPVLEDEKVEYGKVPSSPVEGNREIQYAFEPMILHVQTRSLANAQHLQRVAASCGFRETGIQGSEQKFIVAIRTSLRMDIPIGCLTASEKLQFYITREYMCFLFKRSVEYFTENGNRMARLKEQLERQVEKRMKPRRKLRNMDDYLVQS