TSPO

Translocator protein homolog

196 amino acids

Stress-induced membrane protein that can bind heme and may play a role in the transport of tetrapyrrole intermediates during salt stress and contribute to the detoxification of highly reactive porphyrins in the cytoplasm.

Belongs to the TspO/BZRP family.

21.062 kDa

MDSQDIRYRGGDDRDAATTAMAETERKSADDNKGKRDQKRAMAKRGLKSLTVAVAAPVLVTLFATYFLGTSDGYGNRAKSSSWIPPLWLLHTTCLASSGLMGLAAWLVWVDGGFHKKPNALYLYLAQFLLCLVWDPVTFRVGSGVAGLAVWLGQSAALFGCYKAFNEISPVAGNLVKPCLAWAAFVAAVNVKLAVA

TSPO

Translocator protein

169 amino acids

Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides (PubMed:1649835).

Belongs to the TspO/BZRP family.

18.927 kDa

MAPPWVPAVGFTLLPSLGGFLGAQYTRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAMGYGSYMIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGTRQMGWALVDLLLTGGMAAATAMAWHQVSPPAACLLYPYLAWLAFAGMLNYRMWQDNQVRRSGRRLSE

TSPO

Translocator protein

169 amino acids

Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:24814875), but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides (PubMed:1847678).

Belongs to the TspO/BZRP family.

18.828 kDa

MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE

Tspo

Translocator protein

169 amino acids

Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:9832438, PubMed:24814875), but its precise physiological role is controversial. According to some reports, it is not required for steroid hormone biosynthesis (PubMed:24174323, PubMed:24936060).

Belongs to the TspO/BZRP family.

18.841 kDa

MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE

TSPO

Translocator protein

169 amino acids

Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides (By similarity).

Belongs to the TspO/BZRP family.

18.609 kDa

MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE

Tspo

Translocator protein

169 amino acids

Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis (By similarity). Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides (PubMed:2555358).

Belongs to the TspO/BZRP family.

18.94 kDa

MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE

TSPO

Translocator protein

169 amino acids

Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides (PubMed:11145616).

Belongs to the TspO/BZRP family.

18.916 kDa

MAPPWVPAVGFTLVPSPGGFLGTQYIRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAMGYGSYLIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGARQMGWAFVDLLLTGGMAAATAMAWRQVSPPAACLLYPYLAWLAFAAMLNYRMWQDNQGRRSGRRLSE

tspO

Tryptophan-rich sensory protein

158 amino acids

May play a role in the transmembrane transport of tetrapyrroles and similar compounds, and thereby contribute to the regulation of tetrapyrrole biosynthesis (PubMed:10409680). Binds tetrapyrroles and promotes the photooxidative degradation of protoporphyrin IX (PubMed:23651039). Binds protoporphyrin IX, hemin, and coproporphyrin III, but does not bind delta-aminolevulinic acid (PubMed:23952237, PubMed:20541505, PubMed:25635101). Can bind bilirubin, curcumin, gossypol, retinoic acid, cholesterol and the benzodiazepine receptor agonist PK-11195 (in vitro) (PubMed:23952237, PubMed:25635101). Plays a role in the response to low oxygen levels and in the regulation of the biosynthesis of photosynthetic pigments (PubMed:7673149, PubMed:10409680, PubMed:10681549).

Belongs to the TspO/BZRP family.

17.976 kDa

MNMDWALFLTFLAACGAPATTGALLKPDEWYDNLNKPWWNPPRWVFPLAWTSLYFLMSLAAMRVAQLEGSGQALAFYAAQLAFNTLWTPVFFGMKRMATALAVVMVMWLFVAATMWAFFQLDTWAGVLFVPYLIWATAATGLNFEAMRLNWNRPEARA

tspO

Tryptophan-rich protein TspO

153 amino acids

Binds tetrapyrroles and promotes the photooxidative degradation of protoporphyrin IX (PubMed:23651039). May play a role in the transmembrane transport of tetrapyrroles and similar compounds (By similarity).

Belongs to the TspO/BZRP family.

17.185 kDa

MNILKLVASILAVLAIGFAGSFFTAQSVQTWYAGVEKPFFTPPNWLFGPAWTLLYFLIGIVLYIAWENGFWNDSRVKATFFTQLGLNFLWSILFFGLQNPLAGLVDIIALDIAVILTIVYIYHHSKASLLLLPYLGWILFASALNFAIYLLNA

tspO

Tryptophan-rich protein TspO

153 amino acids

Binds tetrapyrroles and promotes the photooxidative degradation of protoporphyrin IX (PubMed:25635100). Can bind the benzodiazepine receptor agonist PK-11195 (in vitro); this interferes with photooxidative tetrapyrrole degradation (PubMed:25635100). May play a role in the transmembrane transport of tetrapyrroles and similar compounds (By similarity).

Belongs to the TspO/BZRP family.

17.835 kDa

MFMKKSSIIVFFLTYGLFYVSSVLFPIDRTWYDALEKPSWTPPGMTIGMIWAVLFGLIALSVAIIYNNYGFKPKTFWFLFLLNYIFNQAFSYFQFSQKNLFLATVDCLLVAITTLLLIMFSSNLSKVSAWLLIPYFLWSAFATYLSWTIYSIN

TSPO

Putative peripheral benzodiazepine receptor-related protein

102 amino acids

10.537 kDa

MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLRMAGQPWLAWGTAAARVSARPTRDCSCTSRCHHACDVVAVTLS