TRM2

tRNA (uracil(54)-C(5))-methyltransferase

639 amino acids

Catalyzes the formation of 5-methyl-uridine at position 54 (m5U54) in all tRNA. May also have a role in tRNA stabilization or maturation.

Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA M5U methyltransferase family.

72.852 kDa

MYEQFEFSFFFFENSDNKVKYKAHLISSIKRWSIITCMRCFWTVQKSIFKARFFACRNFVKKHNYKLISTMTGSTEMVPPTMKHTVDNKRLSSPLTDSGNRRTKKPKLRKYKAKKVETTSPMGVLEFEVNDLLKSQNLSREQVLNDVTSILNDKSSTDGPIVLQYHREVKNVKVLEITSNGNGLALIDNPVETEKKQVVIIPFGLPGDVVNIKVFKTHPYYVESDLLDVVEKSPMRRDDLIRDKYFGKSSGSQLEFLTYDDQLELKRKTIMNAYKFFAPRLVAEKLLPPFDTTVASPLQFGYRTKITPHFDMPKRKQKELSVRPPLGFGQKGRPQWRKDTLDIGGHGSILDIDECVLATEVLNKGLTNERRKFEQEFKNYKKGATILLRENTTILDPSKPTLEQLTEEASRDENGDISYVEVEDKKNNVRLAKTCVTNPRQIVTEYVDGYTFNFSAGEFFQNNNSILPIVTKYVRDNLQAPAKGDDNKTKFLVDAYCGSGLFSICSSKGVDKVIGVEISADSVSFAEKNAKANGVENCRFIVGKAEKLFESIDTPSENTSVILDPPRKGCDELFLKQLAAYNPAKIIYISCNVHSQARDVEYFLKETENGSAHQIESIRGFDFFPQTHHVESVCIMKRI

TRM2

Tripartite terminase subunit 2

162 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

17.994 kDa

MYGRSNAPGCQPPVRAHPPSSPMTSRLQLAAMEQNASDAALSGMQQARSRQASPKRLRDLIPSSDVESMSLNALDDAYGHHDFSVWFEDLMPPEMELLMPTTDAKLNYLSFTRRLASSVFHSPDNRMPGGACDHTSALDARKERFATIINKFLDLHQILHDA

TRM2

Tripartite terminase subunit 2

157 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

16.968 kDa

MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDEDAEPAAGTSGGLEGGGGDDEDGEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFVNAGQKYAAFLKYVHGDCATCSHGEILREKTQLLTAIVSKLMDINGILEGKDESAPGK

TRM2

Tripartite terminase subunit 2

157 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

16.978 kDa

MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDEDAEPAAGTSGGLEGGGGDDEDGEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFVNAGQKYAAFLKYVHGDCATCSHGEILREKTQLLTAIVSKLMDINGILEGKDEPAPGK

TRM2

Tripartite terminase subunit 2

156 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

17.461 kDa

MYESENASEHHPELEDVFSENTGDSNPSMGSSDSTRSISGMRARDLITDTDVNLLNIDALESKYFPADSTFTLSVWFENLIPPEIEAILPTTDAQLNYISFTSRLASVLKHKESNDSEKSAYVVPCEHSASVTRRRERFAGVMAKFLDLHEILKDA

TRM2

Tripartite terminase subunit 2

134 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

15.301 kDa

MAGENTSRRTGSARLDEVIPEFELVSTDVKILAEKYLQDERIYRIWFEYLIPDEIDLIFPTTDGKLNYLSFTKRLASAIRYGRIKTAVSNNSSSNSYGSTEHVCDHGTSLCGRSERFASVINRFLDLHQILKDC

TRM2

Tripartite terminase subunit 2

130 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

14.437 kDa

MAGREGRTRQRTLRDTIPDCALRSQTLESLDARYVSRDGAHDAAVWFEDMTPAELEVVFPTTDAKLNYLSRTQRLASLLTYAGPIKAPDDAAAPQTPDTACVHGELLAAKRERFAAVINRFLDLHQILRG

TRM2

Tripartite terminase subunit 2

130 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

14.345 kDa

MAGRAGRTRPRTLRDAIPDCALRSQTLESLDARYVSRDGAGDAAVWFEDMTPAELEVIFPTTDAKLNYLSRTQRLASLLTYAGPIKAPDGPAAPHTQDTACVHGELLARKRERFAAVINRFLDLHQILRG

TRM2

Tripartite terminase subunit 2

124 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

14.101 kDa

MASLIGAGTAARLDRVIPEQELAERPLSELFRDYVESAPERRYEVWFFNVTPPEMELALPTTDAKLNYLAHTANLASAVRYDCAGDTDGGRCVHARLLERRRERFAKILNKFLDLHQILGTIQQ

TRM2

Tripartite terminase subunit 2

106 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

12.44 kDa

MMDSSPEKTNLELLYERVCEQGREFEVVFYPMLPRLYEMMLPSLEARLNFLSVGYRHVAFARYVHGDVDCVHREVMAQKMVLLTSILSKLLNVNGILEHQEYLNTE

TRM2

Tripartite terminase subunit 2

106 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

12.428 kDa

MMDSSPEKTNLELLYEQVCEQGREFEVVFYPMLPRLYEMMLPSLEARLNFLSVGYRHVAFSRYVHGDVDCVHREVMAQKMVLLTSILSKLLNVNGILEHQEYLNTE

TRM2

Tripartite terminase subunit 2

92 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

10.691 kDa

MTSFHTRRVEDRDSLIDFQSMLPPDIKIIAPTTYTRLNLLNYCQFLELFMQLRASGCRCEHGEILESKIRAVRQVISKIVETDTVFNGVKKN

TRM2

Tripartite terminase subunit 2

84 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

9.406 kDa

MDLSNLLDFPSILPEDIQVIAPTSYAKLSLLSHCQHLKLFIGQQGSKGVCAHSRVLEEKLEAVKEVISKIIETDKILEKSEKFL

TRM2

Tripartite terminase subunit 2

80 amino acids

Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.

Belongs to the herpesviridae TRM2 protein family.

9.235 kDa

MEYASDQLLPRDMQILFPTIYCRLNAINYCQYLKTFLVQRAQPAACDHTLVLESKVDTVRQVLRKIVSTDAVFSEARARP