TRIM5

Tripartite motif-containing protein 5

551 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

63.521 kDa

MASKILVNIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESRERSCPLCRVSYHSENLRPNRHLANIAERLREVMLSPEEGQKVDRCARHGEKLLLFCQQHGNVICWLCERSEEHRGHRTSLVEEVAQKYREKLQAALEMMRQKEQDAEMLEADVREEQASWKIQIENDKTSTLAEFKQLRDILDCEESNELQKLEKEEENLLKRLVQSENDMVLQTQSIRVLIADLERRLQGSVMELLQGVEGVIKRIKNVTLQKPETFLNEKRRVFQAPDLKGMLQVFKELKEVQCYWAHVTLIPNHPSCTVISEDKREVRYQEQIHHHPSMEVKYFYGILGSPSITSGKHYWEVDVSNKSAWILGVCVSLKCIGNFPGIENYQPQNGYWVIGLRNADNYSAFQDAVPETENYQPKNRNRFTGLQNADNCSAFQNAFPGIQSYQPKKSHLFTGLQNLSNYNAFQNKVQYNYIDFQDDSLSTPSAPLIVPLFMTICPKRVGVFLDYEACTVSFFNVTSNGYLIYKFSNCQFSYPVFPYFSPMTCELPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

547 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

62.555 kDa

MASEILLNIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESTLHQGERSCPLCRVSYQSENLRPNRHLANIAERLREVMLSPEEGQKVDRCARHGEKLLLFCQQHGNVICWLCERSQEHRGHSTFLVEEVAQKYQEKLQVALEMMRQKQQDAEKLEADVREEQASWKIQIENDKTNILAEFKQLRDILDCEESNELQNLEKEEENLLKTLAQSENDMVLQTQSMRVLIADLEHRLQGSVMELLQDVEGVIKRIKNVTLQKPKTFLNEKRRVFRAPDLKGMLQVFKELKEVQCYWAHVTLVPSHPSCTVISEDERQVRYQEQIHQPSVKVKYFCGVLGSPGFTSGKHYWEVDVSDKSAWILGVCVSLKCTANVPGIENYQPKNGYWVIGLQNANNYSAFQDAVPGTENYQPKNGNRRNKGLRNADNYSAFRDTFQPINDSWVTGLRNVDNYNAFQDAVKYSDFQDGSCSTPSAPLMVPLFMTICPKRVGVFLDCKACTVSFFNVTSNGCLIYKFSKCHFSYPVFPYFSPMICKLPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

547 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

62.639 kDa

MASEILVNIKEEVTCPICLDLLTEPLSLDCGHSFCQACITADHKESTLHQGERSCPLCRVGYQSENLRPNRHLANIAERLREVMLSPEEGQKVDRCARHGEKLLLFCQQHGNVICWLCERSQEHRGHSTFLVEEVAQKYREKLQVALEMMREKQQDAEKLEADVREEQASWKIQIKNDKTNILAEFKQLRDILDCEESNELQNLEKEEENLLKILAQSENDMVLQTQSMRVLIADLEHRLQGSVMELLQGVEGIIKRTTNVTLQKPKTFLNEKRRVFRAPNLKGMLQVFKELKEVQCYWAHVTLVPSHPSCAVISEDQRQVRYQKQRHRPSVKAKYFYGVLGSPSFTSGKHYWEVDVSNKSAWILGVCVSLKCTANVPGIENYQPKNGYWVIGLQNADNYSAFQDAVPGTEDYQPKNGCWRNTGLRNADNYSAFQDVFQPKNDYWVTGLWNADNYNAFQDAGKYSDFQDGSCSTPFAPLIVPLFMTIRPKRVGVFLDYEACTVSFFNVTSNGCLIYKFSNCHFSCPVFPYFSPMTCKLPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

515 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

59.262 kDa

MASGILLNVKEEVTCPICLELLTEPLSLPCGHSFCQACITANHKESMLYKEEERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMELLQGVDGIIKRVENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRQVSYQNPQIMYQAPGSSFGSLTNFNYCTGVLGSQSITSRKLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDATYNIEQNENYQPKYGYWVIGLQEGDKYSVFQDSSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

515 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Restricts infection by human immunodeficiency virus type 1 (HIV-1) and N-tropic murine leukemia virus (N-MLV) (PubMed:22291694). Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2 (By similarity).

Belongs to the TRIM/RBCC family.

59.112 kDa

MASGILVNVKEEVTCPICLELLTEPLSLPCGHSLCQACITANHKESMLYKEEERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMELLQGVDGIIKRVENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRQVSYRNPQIMYQSPGSLFGSLTNFSYCTGVPGSQSITSGKLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDATYNIEQNENYQPKYGYWVIGLQEGDKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

515 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Restricts infection by human immunodeficiency virus type 1 (HIV-1), simian immunodeficiency virus (SIV-mac) and N-tropic murine leukemia viruse (N-MLV) (PubMed:22291694). Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2 (By similarity).

Belongs to the TRIM/RBCC family.

59.25 kDa

MASGILVNVKEEVTCPICLELLTEPLSLPCGHSFCQACITANHKESMLYKEEERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADTREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMELLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRQVSYQNPQIMYQAPGSLFGSLTNFNYYTGVRGSQSITSGKLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDATYNIEQNENYQPKYGYWVIGLQEGDKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

497 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Restricts infection by human immunodeficiency virus type 1 (HIV-1) and simian immunodeficiency virus (SIV-agm). Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2 (PubMed:25127057). Also plays a role in autophagy by acting as a selective autophagy receptor which recognizes and targets HIV-1 capsid protein p24 for autophagic destruction (PubMed:25127057).

Belongs to the TRIM/RBCC family.

57.299 kDa

MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWVDVTLAPNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

497 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.266 kDa

MASGILLNVKEEVTCPICLELLTEPLSLPCGHSFCQACITANHRKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGLKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMELLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRQVSSRNPQITYQAPGTLFSFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

497 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.253 kDa

MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMDLLQGVDGIIKRIANMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWVDVTLAPNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKNAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

495 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.127 kDa

MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDHDKTNVLADFEQLREILDREESNELQNLEKEEEDILKSLTKSETKMVQQTQYVRELISDLEHRLQGSMMELLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDVRRCWVDVTLAPNNISHVVIAEDKRQVSSRNPQIMYRTQGTLFQSLTNFIYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

495 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.146 kDa

MASGILVNIKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDRKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDCDKTNVLADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMELLQGVDGIIKRIENMTLKKPKTFPKNQRRVFRAPDLKGILDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRQVSSPNPQIMCRARGTLFQSLKNFIYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPKYGYWVIGLQEGVKYNVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

495 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.212 kDa

MASGILVNIKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDRKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVLADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELVSDLEHRLQGSVMELLQGVDGIIKRIEDMTLKKPKTFPKNQRRVFRAPDLKGMLDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRRVSSPNPQIMYRAQGTLFQSLKNFIYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

495 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.426 kDa

MASGILLNVKEEVTCPICLELLTEPLSLPCGHSFCQACITANHKKSMLYKEEERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDRKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVLADFEQLREILDWEESNELQYLEKEEEDILKSLTKSETKMVRQTQYVRELISDLEHRLQGSMMELLQGVDGIIKRIENMTLKKPETFHKNQRRVFRAPALKGMLDMFRELTDVRRYWVDVTLAPNNISHVVIAEDKRQVSSRNPQIMYWAQGKLFQSLKNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYDVEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIAPLSVIFCPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

495 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Restricts infection by human immunodeficiency virus type 1 (HIV-1) (PubMed:22291694). Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2 (By similarity).

Belongs to the TRIM/RBCC family.

56.967 kDa

MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDHDKTNVLADFEQLREILDREESNELQNLEKEKEDILKSLTKSETKMVQQTQYVRELISDLEHRLQGSMMELLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWVDVTLAPNNISHAVIAEDKRQVSSRNPQIVYQSPGTLFQSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMCNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSLHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.944 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKTSMPDEGERSCPVCRISYQHKNIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCREDRKVICWLCERSQEHRGHHTFLTEEVAQEYQVKLQAALQMLRQKQQEAEELEADIREEKASWKTQIQYDKTNILADFEQLRHILDWVESNELQNLEKEEKDVLKRLMKSEIEMVQQTQSVRELISDLEHRLQGSVMELLQGVDGVIKRMKNVTLKNPETFPKNQRRVFRAADLKVMLKKLRELRDVQHYWVDVTVAPNNISYAVISEDMRQVSSPEPQIIYEAQGTISQTFVNFNYCTGIRGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPKYGYWVIGLEERVKCNAFQDGSFHTPSAPFIVPLSVNICPDRVGVFLDYEACTLSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.98 kDa

MASRILMNIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKKSMLHQGERSCPLCRISYPSENLRPNRHLANIVERLREVMLSPEEGQKVDHCARHGEKLLLFCQQDGNVICWLCERSQEHRGHHTLLVEEVAQTYRENLQVALETMRQKQQDAEKLEADVREEQASWKIQIRDDKTNIMAEFKQLRDILDCEESNELQILEKEEKNILKRLTQSENDMVLQTQSMGVLISDLEHRLQGSVMELLQGVDEVIKRVKNVTLQKPKTFLNEKRRVFRAPDLKGMLQVFKELTEVQRYWVHVTLVPSHLSCAVISEDERQVRYQERIHQSFGKVKYFYGVLGSPSIRSGKHYWEVDVSNKSAWILGVCVSLKCTANRNGPRIENYQPKNGYWVIGLWNAGNYSAFQDSVKYSDFQDGSHSATYGPLIVPLFMTICPNRVGVFLDYEACTVSFFNVTSNGFLIYKFSNCRFSDSVFPYFSPMTCELPMTLCSPRS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.782 kDa

MASRILVNIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESTLHQGERSCPLCRISYPSENLRPNRHLANIVERLREVVLSPEEGQKVDLCARHGEKLLLFCQQDGNVICWLCERSQEHRGHHTFLVEEVAQTYRENLQVVLEMMRQKHQDAEKLEADVREEQASWKIQIQNDKTNIMAEFKQLRDILDCEESNELQNLEKEEKNILKRLVQSENDMVLQTQSISVLISDLEHRLQGSVMELLQGVDGVIKRVKNVTLQKPKTFLNEKRRVFRVPDLKGMLQVSKELTEVQRYWAHVTLVASHPSRAVISEDERQVRYQEWIHQSSGRVKYFYGVLGSPSITSGKHYWEVDVSNKSAWILGVCVSLKCAANRNGPGVENYQPKNGYWVIGLRNADNYSAFQDSVKYNDFQDGSRSTTYAPLIVPLFMTICPNRVGVFLDYEACTVSFFNVTSNGFLIYKFSNCHFSYPVFPYFSPMTCELPMTLCSPRS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.096 kDa

MASGILVNIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESTPHQGERSCPLCRMSYPSENLRPNRHLANIVERLKEVMLSPEEGQKVGHCARHGEKLLLFCEQDGNVICWLCERSQEHRGHHTLLVEEVAEKYQEKLQVALEMMRQKQQDAEKLEADVREEQASWKIQIRNDKTNIMAEFKQLRDILDCEESKELQNLEKEEKNILKRLVQSESDMVLQTQSMRVLISDLERRLQGSVLELLQGVDDVIKRIETVTLQKPKTFLNEKRRVFRAPDLKAMLQAFKELTEVQRYWAHVTLVPSHPSYAVISEDERQVRYQFQIHQPSVKVNYFYGVLGSPSITSGKHYWEVDVTNKRDWILGICVSFKCNAKWNVLRPENYQPKNGYWVIGLQNTNNYSAFQDAVKYSDFQIGSRSTASVPLIVPLFMTIYPNRVGVFLDYEACTVSFFNVTNNGFLIYKFSNCHFSYPVFPYFSPMTCELPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.047 kDa

MASRILVNIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESTPHQGERSCPLCRMSYPSENLRPNRHLANIVERLKEVMLSPEKGQKVGHCARHGEKLLLFCEQDGNVICWLCERSQEHRGHHTFLVEEVAEKYQEKLQVALEMMRQKQQDAEKLEADVREEQASWKIQIRNDKTNIMAEFKQLRDILDCEESKELQNLEKEEKNILKRLVQSESDMALQTQSMRVLISDLERRLQGSVLELLQGVDDVIKRIETVTLQKPKTFLNEKRRVFRAPDLKGMLQAFKELTEVQRYWAHVTLVPSHPSYTVISEDERQVRYQFPIHQPSVKVNYFYGVLGSPSITSGKHYWEVDVSNKRAWILGVCVSLKYNAKWNVLRPENYQPKNGYWVIGLQNTNNYSAFQDAVKYSDFQIGSRSTASVPLIVPLFMTICPNRVGVFLDYEACTVSFFNVTNNGFLIYKFSNCHFSYPVFPYFSPVTCELPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

57.148 kDa

MASGILGSIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESMLHQGERSCPLCRLPYQSENLRPNRHLASIVERLREVMLRPEERQNVDHCARHGEKLLLFCEQDGNIICWLCERSQEHRGHNTFLVEEVAQKYREKLQVALETMRQKQQDAEKLEADVRQEQASWKIQIQNDKTNIMAEFKQLRDILDCEESNELQNLEKEEKNILKRLVQSENDMVLQTQSVRVLISDLERRLQGSVVELLQDVDGVIKRIEKVTLQKPKTFLNEKRRVFRAPDLKRMLQVLKELTEVQRYWAHVTLVPSHPSYTIISEDGRQVRYQKPIRHLLVKVQYFYGVLGSPSITSGKHYWEVDVSNKRAWTLGVCVSLKCTANQSVSGTENYQPKNGYWVIGLRNAGNYRAFQSSFEFRDFLAGSRLTLSPPLIVPLFMTICPNRVGVFLDYEARTISFFNVTSNGFLIYKFSDCHFSYPVFPYFNPMTCELPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Restricts infection by simian immunodeficiency virus (SIV-mac)(PubMed:22291694). Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2 (By similarity).

Belongs to the TRIM/RBCC family.

57.316 kDa

MASRILGSIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESMLHQGERSCPLCRLPYQSENLRPNRHLASIVERLREVMLRPEERQNVDHCARHGEKLLLFCEQDGNIICWLCERSQEHRGHNTFLVEEVAQKYREKLQVALETMRQKQQDAEKLEADVRQEQASWKIQIQNDKTNIMAEFKQLRDILDCEESNELQNLEKEEKNILKRLVQSENDMVLQTQSVRVLISDLERRLQGSVVELLQDVDGVIKRIEKVTLQKPKTFLNEKRRVFRAPDLKRMLQVLKELTEVQRYWAHVTLVPSHPSYTIISEDGRQVRYQKPIRHLLVKVQYFYGVLGSPSITSGKHYWEVDVSNKRAWTLGVCVSLKCTANQSVSGTENYQPKNGYWVIGLRNAGNYRAFQSSFEFRDFLAGSRLTLSPPLIVPLFMTICPNRVGVFLDYEARTISFFNVTSNGFLIYKFSDCHFSYPVFPYFNPMTCELPMTLCSPRS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.799 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKTSMPDEGERSCPVCRISYQHKNIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDRKVICWLCERSQEHRGHHTFLTEEVAQEYQVKLQAALQMLRQKQQEAEELEADIREEKASWKTQIQYDKTNILADFEQLRHILDWVESNELQNLEKEEKDVLKRLMRSEIEMVQQTQSVRELISDLEHRLQGSVMELLQGVDGVIKRMKNVTLKKPETFPKNRRRVFRAADLKVMLEVLRELRDVRRYWVDVTVAPNNISYAVISEDMRQVSSPEPQIIFEAQGTISQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPKYGYWVIGLEEGVKCNAFQDGSIHTPSAPFIVPLSVNICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.925 kDa

MASRILVNIKEEVTCPICLELLTEPLSLDCGHSFCQACITANHKESTLHQGERSCPLCRMSYPSENLRPNRHLANIVERLKEVMLSPEEGQKVDHCARHGEKLLLFCQQDGNVICWLCERSQEHRGHHTFLVEEVAEKYQGKLQVALEMMRQKQQDAEKLEADVREEQASWKIQIQNDKTNIMAEFKQLRDILDCEESKELQNLEKEEKNILKRLVQSESDMVLQTQSIRVLISDLERRLQGSVMELLQGVDDVIKRIEKVTLQKPKTFLNEKRRVFRAPDLKGMLQAFKELTEVQRYWAHVTLVPSHPSCTVISEDERQVRYQVPIHQPLVKVKYFYGVLGSLSITSGKHYWEVDVSNKRGWILGVCGSWKCNAKWNVLRPENYQPKNGYWVIGLRNTDNYSAFQDAVKYSDVQDGSRSVSSGPLIVPLFMTICPNRVGVFLDYEACTISFFNVTSNGFLIYKFSNCHFSYPVFPYFSPTTCELPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

494 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.859 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKTSMPDEGERSCPVCRISYQHKNIRPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCREDRKVICWLCERSQEHRGHHTFLTEEVAQEYQMKLQAALQMLRQKQQEAEELEADIREEKASWKTQIQYDKTNILADFEQLRHILDWVESNELQNLEKEKKDVLKRLMKSEIEMVQQTQSVRELISDLEHRLQGSVMELLQGVDGIIKRMKNVTLKKPETFPKNKRRVFRAADLKVMLEVLRELRDVRRYWVDVTVAPNNISYAVISEDMRQVSSPEPQIICEAQGTISQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGLQPDAMYNIEQNENYQPKCGYWVIGLEERVKCNAFQDGSFHTPSAPFIVPLSVNICPDRVGVFLDYEACTVSFFNITDHGFLIYKFSRCSFSQPVFPYLNPRKCTVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

493 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.35 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQSVRELISDLERRLQGSVMELLQGVDGVIKRMENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDMRQVSSPKPQIIYGARGTRYQTFMNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDGSFHTPSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

493 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.271 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCAHHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQSVRELISDLERRLQGSVMELLQGVDGVIKRMENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDMRQVSSPKPQIIYGARGTRYQTFMNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDGSFHTPSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGSLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

493 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.435 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSTLDKGERSCPVCRVSYQPKNIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCKEDGKVICWLCERSQEHRGHHTFLTEEVAQKYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTSVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQSVRELISDVEHRLQGSVMELLQGVDGIIKRMQNVTLKKPETFPKNQRRVFRAPNLKGMLEVFRELTDVRRYWVDVTVAPNDISYAVISEDMRQVSCPEPQITYGAQGTTYQTYVNFNYCTGILGSQSITSGKHYWEVNVSKKSAWILGVCAGFQPDAMYNIEQNENYQPQYGYWVIGLEEGVKCSAFQDGSFHNPSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCRVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

493 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.434 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSTLDKGERSCPVCRVSYQPKNIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCKEDGKVICWLCERSQEHRGHHTFLTEEVAQKYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTSVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQSVRELISDVEHRLQGSVMELLQGVDGVIKRMQNVTLKKPETFPKNQRRVFRAPNLKGMLEVFRELTDVRRYWVDVTVAPNDISYAVISEDMRQVSCPEPQIIYGAQGTTYQTYVNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPQYGYWVIGLEEGVKCSAFQDGSFHNPSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCRVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

493 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.382 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHEKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAQECQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKRLTKSETEMVQQTQSVRELISDLEHRLQGSVMELLQGVDGVIKRMENVTLKKPETFPKNRRRVFRAPDLKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDMRQVSSPKPQIIYGAQGTRYQTFMNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDATCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDGSFHTPSAPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCRVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

493 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Restricts infection by N-tropic murine leukemia virus (N-MLV), equine infectious anemia virus (EIAV), simian immunodeficiency virus of macaques (SIVmac), feline immunodeficiency virus (FIV), and bovine immunodeficiency virus (BIV) (PubMed:17156811). Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2 (PubMed:25127057). Also plays a role in autophagy by acting as a selective autophagy receptor which recognizes and targets HIV-1 capsid protein p24 for autophagic destruction (PubMed:25127057).

Belongs to the TRIM/RBCC family.

56.338 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHTPSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS

TRIM5

Tripartite motif-containing protein 5

493 amino acids

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restriction factor, also acts as a pattern recognition receptor that activates innate immune signaling in response to the retroviral capsid lattice. Binding to the viral capsid triggers its E3 ubiquitin ligase activity, and in concert with the heterodimeric ubiquitin conjugating enzyme complex UBE2V1-UBE2N (also known as UBC13-UEV1A complex) generates 'Lys-63'-linked polyubiquitin chains, which in turn are catalysts in the autophosphorylation of the MAP3K7/TAK1 complex (includes TAK1, TAB2, and TAB3). Activation of the MAP3K7/TAK1 complex by autophosphorylation results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, thereby leading to an innate immune response in the infected cell. Plays a role in regulating autophagy through activation of autophagy regulator BECN1 by causing its dissociation from its inhibitors BCL2 and TAB2.

Belongs to the TRIM/RBCC family.

56.733 kDa

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKTSMPDGERSCPVCRISYQHKNIRPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCREDRKVICWLCERSQEHRGHHTFLMEEVAQEYQVKLQAALQMLRQKQQEAEQLEADIREEKASWKTQIQYDKTNILADFEQLRHILDWVESNELQNLEKEEKDVLRRLMKSEIEMVQQTQSVRELISDLEHRLQGSVMELLQGVDGVIKRMKNMTLKKPETFPKNKRRVFRAADLQVTLEVLRELRDVRRYWVDVTVAPNNISYAVISEDMRQVSSPEPQIIYEAQGTISQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDAMYNIEQNENYQPKYGYWVIGLEEGVKCNAFQDGSSHTPSAPFIVPLSVKICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCTVPMTLCSPSS