TRADD

Tumor necrosis factor receptor type 1-associated DEATH domain protein

312 amino acids

Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B (By similarity). The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A (By similarity).

34.292 kDa

MAAGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHQQQKVAMYGALQTALAESGGSPDVLQMLKIHRSDPQLIVQLRFSGRQACSRFLRAYREGALRATLQGCLARALALNSVPLQLELRAGAEQLDALLTNEERCLNCICAQKPDRLRDEELTELENALRNLTCGSAGGQGSDVQGTPAPLQSLAPSPPEEKPPPPQPGQTFLFQGQPIVNRPLNLQDQQKFARSVGLKWRKVGRSLQRSCRALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLANPDGSLA

TRADD

Tumor necrosis factor receptor type 1-associated DEATH domain protein

312 amino acids

The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A (By similarity). Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B.

34.247 kDa

MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA

Tradd

Tumor necrosis factor receptor type 1-associated DEATH domain protein

310 amino acids

Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B (By similarity). The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A.

34.577 kDa

MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA

tradd

Tumor necrosis factor receptor type 1-associated DEATH domain protein

303 amino acids

Adapter molecule for tnfrsf1a that specifically associates with the cytoplasmic domain of activated tnfrsf1a mediating its interaction with fadd.

34.377 kDa

MAAGPSMWVGSVYLYIKSDTVPLPGKYTHQKALIYEALRSAISESTRGCRDSIEILKIHSSDQQLILYLKFCGLEPCQRFLKDYKECKVQMQIQNKLKNCFSVEGLPIFTELKIDTGEIDSLLEKEEQCLKYISQMKPTIQKDDELAEIDERLKSIKLDSPSALDSELSLQNSCQCSLPLSLHSNRSYHIEGSTFHFQGEEFVDRPLTSAHIQHFAKSVGKNWKPVGRSLGKTCRALNDTAIENLAYEFDRDGRYEQAYQLLRLFKDSEGKKATVQRLVQALEENGLNSIALDLLSLNENGLK

tradd

Tumor necrosis factor receptor type 1-associated DEATH domain protein

293 amino acids

Adapter molecule for tnfrsf1a that specifically associates with the cytoplasmic domain of activated tnfrsf1a mediating its interaction with fadd.

33.151 kDa

MDSIDTKRLNDSNASDRALSGCAVLFLGCSSLEHNFLSLYKDERGKFSVFKVIKLTLSDSVGGLEGYEILKLHDADPYLGVELKFMAMPPCQRFLESYACGSLTQFLSQHASRLLALPDGVEIETQLKAGVHTLDHSLQDIEICLDHIRQSQPVRLRDDEVTQLEQQLQNSYGPPSQPPQELPRNCFLFQKRVFDDRPLTPADQQRFAAHVGRDWKRVGRALQKNCRALKGPAIDNLAYEYEREGLYEQAYQLLGRFIQSEGRSAKLSRLISALEETKMTSMAEIMLGIQPRD

tradd

Tumor necrosis factor receptor type 1-associated DEATH domain protein

292 amino acids

Adapter molecule for tnfrsf1a that specifically associates with the cytoplasmic domain of activated tnfrsf1a mediating its interaction with fadd.

32.697 kDa

MVALSVEVGPWTGCAVLFLRSCPAVNLLSLYKDQQGKFSVFKVLKLTLTDSAGGLEGYEILKLHDADPLLGVEVKFVDVAACRRFLQSYGSGAVQQSLSQHTCRLLHIPQQELALETQLKAGTHTLDFCLDDLELCLQHIHQSQPERLRDDEIAELDQQLQSQALGHIPQPPTLTQEEPPVPSNCFLFQKRVFEDRMLAAGDLQRFSNGVGRDWRKVGRALGKNCRALKGPAIDNLAYEYEREGLYEQAYQLLSRFIQAEGRAARLGRLVRALEDSKLTSLAENILDIQPRD