TMEM119

Transmembrane protein 119

283 amino acids

Plays an important role in bone formation and normal bone mineralization. Promotes the differentiation of myoblasts into osteoblasts (PubMed:20025746). May induce the commitment and differentiation of myoblasts into osteoblasts through an enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway. Upregulates the expression of ATF4, a transcription factor which plays a central role in osteoblast differentiation. Essential for normal spermatogenesis and late testicular differentiation (By similarity).

29.203 kDa

MVSAAAPSLLILLLLLLGSVPATDARSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVMLIAVVGSLAFLLMFIVCAAVITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSV

Tmem119

Transmembrane protein 119

280 amino acids

Plays an important role in bone formation and normal bone mineralization (PubMed:26207632, PubMed:22416756, PubMed:20025746). Promotes the differentiation of myoblasts into osteoblasts (PubMed:22416756, PubMed:20025746, PubMed:22579779). May induce the commitment and differentiation of myoblasts into osteoblasts through an enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway (PubMed:21239498, PubMed:22579779). Upregulates the expression of ATF4 which plays a central role in osteoblast differentiation (PubMed:24362451). Essential for normal spermatogenesis and late testicular differentiation (PubMed:26207632).

29.401 kDa

MVPWFLLSLLLLARPVPGVAYSVSLPASFLEDVAGSGEAEGSSASSPSLPPPGTPAFSPTPERPQPTALDGPVPPTNLLEGIMDFFRQYVMLIAVVGSLTFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSV