TMEM106A

Transmembrane protein 106A

262 amino acids

Activates macrophages and polarizes them into M1-like macrophages through the activation of the MAPK and NF-kappaB signaling pathway. Upon activation, upregulates the expression of CD80, CD86, CD69 and MHC II on macrophages, and induces the release of pro-inflammatory cytokines such as TNF, IL1B, IL6, CCL2 and nitric oxide (By similarity). May play a role in inhibition of proliferation and migration (PubMed:30456879, PubMed:29131025).

Belongs to the TMEM106 family.

28.92 kDa

MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQELEKQLVALIPYGDQRLKPKHTKLFVFLAVLICLVTSSFIVFFLFPRSVIVQPAGLNSSTVAFDEADIYLNITNILNISNGNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIRDENTYKICTWLEIKVHHVLLHIQGTLTCSYLSHSEQLVFQSYEYVDCRGNASVPHQLTPHPP

TMEM106A

Transmembrane protein 106A

261 amino acids

Activates macrophages and polarizes them into M1-like macrophages through the activation of the MAPK and NF-kappaB signaling pathway. Upon activation, upregulates the expression of CD80, CD86, CD69 and MHC II on macrophages, and induces the release of pro-inflammatory cytokines such as TNF, IL1B, IL6, CCL2 and nitric oxide (By similarity). May play a role in inhibition of proliferation and migration (By similarity).

Belongs to the TMEM106 family.

28.828 kDa

MGETFSQLASQKDENKLILPPNPAFGSKAASYSSMGNSRPFFSCVPCERAAGAGFVTCPTCQGSGEIPRELEKQLVALIPYGDQRLKPRHTKLSVFLAVSICLVTSSLIIFFLFPRTIAVQPVGLNSSTVATDEANVYLNITSILNISNNNYCPITVTQLTIEVLHLSLVVGQVSHSLLLHIGPLASEQMFYAVTNRINDENTYKICTWLEIKVHHVLLYIQGTLTYSYLSRSEQLVFQSYEYVDCRGNTSVPHLLVSHPP

Tmem106a

Transmembrane protein 106A

261 amino acids

Activates macrophages and polarizes them into M1-like macrophages through the activation of the MAPK and NF-kappaB signaling pathway (PubMed:26215746). Upon activation, upregulates the expression of CD80, CD86, CD69 and MHC II on macrophages, and induces the release of pro-inflammatory cytokines such as TNF, IL1B, IL6, CCL2 and nitric oxide (PubMed:26215746). May play a role in inhibition of proliferation and migration (By similarity).

Belongs to the TMEM106 family.

29.109 kDa

MGKAVSQLTSRKDEDKPILPDNPAMASQAANYFSTGSSKPAHSCMPYEKAASSSFVTCPTCQGNGEIPQEQEKQLVALIPYGDQRLKPRRTKLFVFLSVAICLLIFSLTIFFLYPRPIAVRPVGLNSSTVTFEDAHVQLNTTNVLNIFNSNFYPITVTQLTAEVLHQASVVGQVTSSLRLHIGPLASEQMPYEVASRILDENTYKICTWPKIRVHHILLNIQGSLTCSFLSHPQQLPFESFEYVDCRENMSLPHLELPRPA

Tmem106a

Transmembrane protein 106A

261 amino acids

Activates macrophages and polarizes them into M1-like macrophages through the activation of the MAPK and NF-kappaB signaling pathway. Upon activation, upregulates the expression of CD80, CD86, CD69 and MHC II on macrophages, and induces the release of pro-inflammatory cytokines such as TNF, IL1B, IL6, CCL2 and nitric oxide (By similarity). May play a role in inhibition of proliferation and migration (By similarity).

Belongs to the TMEM106 family.

29.136 kDa

MGKAFSQLTSQKDEDKSILPDNPAMASKAANYFSTGNRKPSHSCVPCEKAASTSFVTCPTCQGNGEIPQELEKQLVALIPYGDQRLKPRRTKLSVFLAVTICLLIFSLTIFFLYPRNIVVHPVGLNSSTVAFDETHVQLNMTNVLNITNSNFYPVTVTQLTAEVLHQTSVVGQVTSSLRLHIGPLASKQMPYEVASRILDENTYKICTWPKIRVHHILVNIQGALTCSYLTHPQQLPFESFEYVDCRENMSMPHLELPRPA