TIMP3

Metalloproteinase inhibitor 3

214 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

24.498 kDa

MVFSTTAALSLLLALSSMQLSEVSEACTCMPNHPQEAFCNSDIVIRAKVVGKKLLKDGPFGTMRYTIKQMKMYRGFSKMQQVQYIYTEAAESLCGVRLQVNKFQYLITGRVFDGEVYTGVCNFIVPWDRLTLSQRKGLNHRYQYGCNCKIKPCYYLPCFVTAKNECFWTDMLSDQGYMGHQAKHYVCIRQKEGYCSWYRGAAPPDKTRINATDP

timp3

Metalloproteinase inhibitor 3

214 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.

Belongs to the protease inhibitor I35 (TIMP) family.

24.456 kDa

MSVCALTLILGCFLLFLGDISKPAEGCTCAPSHPQDAFCNSDIVIRAKVVGKKLMKDGPFGTMRYTVKQMKMYRGFNKMPQVQYIYTEASESLCGVKLEVNKYQYLITGRVYEGKVYTGLCNLIERWEKLTFAQRKGLNHRYPLGCTCKIKPCYYLPCFITSKNECLWTDMLSNFGYPGYQSKNYACIKQKEGYCSWYRGWAPPDKTTINTTDP

TIMP3

Metalloproteinase inhibitor 3

212 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.

Belongs to the protease inhibitor I35 (TIMP) family.

24.505 kDa

MTAWLGFLAVFLCSWSLRDLVAEACTCVPIHPQDAFCNSDIVIRAKVVGKKLMKDGPFGTMRYTVKQMKMYRGFQIMPHVQYIYTEASESLCGVKLEVNKYQYLITGRVYEGKVYTGLCNWYEKWDRLTLSQRKGLNHRYHLGCGCKIRPCYYLPCFATSKNECIWTDMLSNFGHSGHQAKHYACIQRVEGYCSWYRGWAPPDKTIINATDP

TIMP3

Metalloproteinase inhibitor 3

211 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.

Belongs to the protease inhibitor I35 (TIMP) family.

24.197 kDa

MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTMVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

TIMP3

Metalloproteinase inhibitor 3

211 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.

Belongs to the protease inhibitor I35 (TIMP) family.

24.147 kDa

MTPWLGLVVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCYVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

TIMP3

Metalloproteinase inhibitor 3

211 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.

Belongs to the protease inhibitor I35 (TIMP) family.

24.145 kDa

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

TIMP3

Metalloproteinase inhibitor 3

211 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15 (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

24.145 kDa

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

TIMP3

Metalloproteinase inhibitor 3

211 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15 (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

24.145 kDa

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Timp3

Metalloproteinase inhibitor 3

211 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.

Belongs to the protease inhibitor I35 (TIMP) family.

24.182 kDa

MTPWLGLVVLLSCWSLGHWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP

Timp3

Metalloproteinase inhibitor 3

211 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.

Belongs to the protease inhibitor I35 (TIMP) family.

24.226 kDa

MTPWLGLVVLLSCWSLGHWGTEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKKECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP

TIMP3

Metalloproteinase inhibitor 3

151 amino acids

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

17.595 kDa

single

CNSDIVIRAKVVGKKLVKEGPFGTMVYTVKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKVYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIR