TIMM17B

Mitochondrial import inner membrane translocase subunit Tim17-B

172 amino acids

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the Tim17/Tim22/Tim23 family.

18.321 kDa

MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGMRHRLRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSVPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPGQLPSKEGTPGPGYPSYQQYH

TIMM17B

Mitochondrial import inner membrane translocase subunit Tim17-B

172 amino acids

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the Tim17/Tim22/Tim23 family.

18.273 kDa

MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Timm17b

Mitochondrial import inner membrane translocase subunit Tim17-B

172 amino acids

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the Tim17/Tim22/Tim23 family.

18.352 kDa

MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLTPKEGSPAPGYPNYQQYH