TIMM17A

Mitochondrial import inner membrane translocase subunit Tim17-A

171 amino acids

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the Tim17/Tim22/Tim23 family.

18.024 kDa

MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Timm17a

Mitochondrial import inner membrane translocase subunit Tim17-A

171 amino acids

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the Tim17/Tim22/Tim23 family.

18.112 kDa

MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGINHRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFTEDHSQLPSSQLPSSPFGDYRQYQ

Timm17a

Mitochondrial import inner membrane translocase subunit Tim17-A

171 amino acids

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Belongs to the Tim17/Tim22/Tim23 family.

18.038 kDa

MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDHSQLPSSQLPSSPFGDYRQYQ