TIM9

Mitochondrial import inner membrane translocase subunit TIM9

93 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.715 kDa

MDASMMAGLDGLPEEDKAKMASMIDQLQLRDSLRMYNSLVERCFVDCVDSFTRKSLQKQEETCVMRCAEKFLKHTMRVGMRFAELNQNAPTQD

TIM9

Mitochondrial import inner membrane translocase subunit Tim9

93 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.879 kDa

MDKNMLGDLDNLPEEDKLKMASMIEQLQIRDSLRMYNNLVERCFTDCVDSFRRKTLDKQEETCVKRCAEKFLKHSMRVGLRFAELNQGAATTD

TIM9

Mitochondrial import inner membrane translocase subunit Tim9

93 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.84 kDa

MDKSMLGDLDGLPEEDKMRMAAMVDQLQIRDSLRMYNSLVERCFTDCVDTFRRKTLDKQEESCVRRCAEKFLKHSMRVGMRFAELNQGVATPD

tim9

Mitochondrial import inner membrane translocase subunit tim9

90 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.468 kDa

MDGLTAAEQRELASRMERKQLKEFMTMYSKLVQRCFDNCVNDFTTKSLISREEGCIMRCVDKYMKASSRLNERFQEQNAAMMQGGQLPGR

tim9

Mitochondrial import inner membrane translocase subunit tim9

90 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.554 kDa

MDGLNAAEQRELANRMERKQMKEFMTMYSKLVQRCFDDCVNDFTTKSLISREEGCVMRCVDKFMKGSQRLNERFQEQNAAMMQSGQLPGR

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

89 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.074 kDa

MDFSQFNGAEQAHMSKVIEKKQMQDFMRLYSGLVEKCFNACAQDFTSKALTTNETTCVQNCTDKFLKHSERVGARFAEHNAEQMQGAGQ

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

89 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.074 kDa

MDFSQFNGAEQAHMSKVIEKKQMQDFMRLYSGLVEKCFNACAQDFTSKALTTNETTCVQNCTDKFLKHSERVGARFAEHNAEQMQGAGQ

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

88 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.49 kDa

MDQLNVKEQQDFQQIVEQKQMKDFMRLYSNLVSKCFDDCVNDFTSNNLTTKETGCITKCSEKFLKHSERVGQRFQEQNALLMQNMQKR

tim9

Mitochondrial import inner membrane translocase subunit tim9

88 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

Belongs to the small Tim family.

9.86 kDa

MDGLTAAESRELDQRLQKRQVKEFMSVFGNLVDNCFTACVDDFTSKALSGRESGCISRCVLKSMSTQTRLGERFGELNAAMTAEMQRR

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.336 kDa

MDALNSREQQEFQRVVEQKQMKDFMRLYSNLVERCFSDCVNDFTSSKLTSKEQTCIMRCSEKFLKHSERVGQRFQEQNAALNQSMGR

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Compared to TIM10, it may have a strong structural role.

Belongs to the small Tim family.

10.202 kDa

MDALNSKEQQEFQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQNAALGQGLGR

TIM9

Mitochondrial import inner membrane translocase subunit Tim9

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.198 kDa

MDSLNPREQQEFSKLIEHKQMKDFMRLYSNLVERCFTDCVNDFTSSKLTSKEQTCISRCSEKFLKHSERVGLRFQEQNAAMGQGLGR

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.202 kDa

MDQLNVKEQQEFQQIVEQKQMKDFMNLYSNLVSRCFDDCVNDFTSNSLTSKETSCIAKCSEKFLKHSERVGQRFQEQNALLMQQGPK

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.128 kDa

MDQLNAKEQQEFQKLVEQKQMKDFMRLYSGLVERCFTDCVNDFTSSKLTSKEESCILKCSEKFLKHSERVGQRFQEQNAALGQGLGR

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.08 kDa

MDMLSAAEQRTLEQRMQKRQVKEFMGAFGGLVEHCFMSCVDDFTSKAISNRESGCINRCVQKWMASQQRISDRFQEHNAQLTAQMNK

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.35 kDa

MDQLNGKEQQEFQKIVEQKQMKDFMRLYSNLVERCFSDCVNDFTSAKLTSKEQNCIMRCSEKFLKHSERVGQRFQEQNAAMNQTMGR

TIM9

Mitochondrial import inner membrane translocase subunit TIM9

85 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

10.217 kDa

MDQLNNREQQEFQQLVEQKQMKDFMRLYSSLVQRCFTDCVNDFTSKALSSREESCLEKCSEKFLKHSERVGQRFQEQNAALMQKR

tim9

Mitochondrial import inner membrane translocase subunit tim9

84 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).

Belongs to the small Tim family.

9.805 kDa

MDRLNVKEQEHLTQVLEAKQLKEYLNMYSTLTQNCFSDCVQDFTSSKLSNKESECIAKCADKFLKHSERVGQRFAEFNAKYMGQ