tim8

Mitochondrial import inner membrane translocase subunit tim8

98 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

11.355 kDa

MADATKNPIADLSESEQLELSKFIESEQQKVKLQQAIHQFTSTCWPKCIGNIGNKLDKSEEQCLQNCVERFLDCNFHIIKRYALEKFGFLFCWLGFSC

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

93 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.784 kDa

MSAQQLNIDNADLEKLNDKDRTELRQFLANEQQRSQIQAQTHSLTQMCWSKCVPGTIKNPKLDKSEETCLANCVERFLDVNYLTMKHLNGMRN

tim8

Mitochondrial import inner membrane translocase subunit tim8

92 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The tim8-tim13 complex is non essential and only mediates the import of few proteins, while the predominant tim9-tim10 70 kDa complex is crucial and mediates the import of much more proteins.

Belongs to the small Tim family.

10.42 kDa

MDIPQADLDLLNEKDKNELRGFISNETQRQRVQGQTHALTDSCWKKCVTSPIKTNQLDKTEAVCMADCVERFLDVNLTIMAHVQKITRGGSK

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

90 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.05 kDa

MSQISQTALASLDESSRKDIMQFIESENSKSKVQMSIHNFTDMCFKKCNANKPITSGTLDSSEEQCLTNCLNRFLDTNIKVVQALQGAQK

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

88 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.876 kDa

MSSLSTTAIQSLDEASRKEIMQFVESEQSKSKVQSSIHNFTDMCFKKCNKDKPITSATLDGQEEACLKNCLNRFLDTNIKVVEALQGR

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

88 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.81 kDa

MSAPTSIPALDEASKKELESFLEQEQAKAKLQASIHELTNTCWNTCITGGISSKFSKSEAQCLENCVDRFLDSSLYIVRQIEAQKQQI

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

88 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.81 kDa

MSAPTSIPALDEASKKELESFLEQEQAKAKLQASIHELTNTCWNTCITGGISSKFSKSEAQCLENCVDRFLDSSLYIVRQIEAQKQQI

Tim8

Mitochondrial import inner membrane translocase subunit Tim8

88 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The Tim8-Tim13 complex mediates the import of some proteins while the predominant Tim9-Tim10 70 kDa complex mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

10.062 kDa

MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQRFAQMLQKRGGGDL

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.873 kDa

MSGISPTELQNLDEPSKKEIMGFLETENSKQKVQMSIHQFTNLCFKNCIHSVQSADLSAQENQCLKDCVNRFLDTNIRIVKGLQSIQ

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.685 kDa

MSNLNPGELGDLTDASKKEIAAYLDAENSKQKVRTSINQFTDICFKKCISRVDNGNLSSQEEECLASCVNRFLDTNIRVVRGLQNSQ

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

9.888 kDa

MSSISQNDLSNLDDGSKKEIMTFLESENSKQKVQMSIHQFTNLCFKNCISNVQNADLSSQEEQCLNNCVNRFLDTNIRIVKGLQSIQ

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

87 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins under precise conditions, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins. Strictly required for import of TIM23 in some conditions, when a low membrane potential exists in the mitochondria.

Belongs to the small Tim family.

9.764 kDa

MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR

TIM8

Mitochondrial import inner membrane translocase subunit TIM8

77 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex mediates the import of some proteins while the predominant TIM9-TIM10 70 kDa complex mediates the import of much more proteins (By similarity).

Belongs to the small Tim family.

8.75 kDa

MDPSMANNPELLQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMIIMKRFNSQ