TIF5

Eukaryotic translation initiation factor 5

405 amino acids

Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]). eIF-5 is essential for cell viability.

Belongs to the eIF-2-beta/eIF-5 family.

45.261 kDa

MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADISHALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSCKNPETEIIITKDNDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSVSGSKKKKKAATASANVRGGGLSISDIAQGKSQNAPSDGTGSSTPQHHDEDEDELSRQIKAAASTLEDIEVKDDEWAVDMSEEAIRARAKELEVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAESDDDEEDDE

TIF5

Eukaryotic translation initiation factor 5

405 amino acids

Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]). eIF-5 is essential for cell viability.

Belongs to the eIF-2-beta/eIF-5 family.

45.261 kDa

MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADISHALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSCKNPETEIIITKDNDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSVSGSKKKKKAATASANVRGGGLSISDIAQGKSQNAPSDGTGSSTPQHHDEDEDELSRQIKAAASTLEDIEVKDDEWAVDMSEEAIRARAKELEVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAESDDDEEDDE

tif5

Probable eukaryotic translation initiation factor 5

395 amino acids

Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]) (By similarity).

Belongs to the eIF-2-beta/eIF-5 family.

44.944 kDa

MATINIRRDVKDSFYRYRMPKLQSKIEGKGNGIKTVIPNMSDIAKALGRPPLYVTKFFGFELGAQTTIIADMDRYIVNGAHDAGKLQDLLDVFIRRFVLCASCQNPETELSINKKDQTISYDCKACGYRGVIDGRHKLTGVIVKNPPAKKKSHKHKRDSPVAEEEDGAEDELTRRIRQEAAELPTAEVVNDEDWAVDTSEEAVRARVQELEGNMKDSLTLSDLRGDEEEAESSRYDQFGEWLEDNYPGVSDVEIYKKMKEENIHHKSKAIVVLVQCIITSPYVGEFEKHGALFKKLCTTDKHERALLGGFERLMENTELVHIDVVPKVLLEIYQNDLVSDDMFEKWGAKASKKYVSRETSKKIHEAAEPFLTWLAEASDESESEDEEEEEEDDDE