TIF45

Eukaryotic translation initiation factor 4E

211 amino acids

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Belongs to the eukaryotic initiation factor 4E family.

24.025 kDa

MSVEEVTQKAQALSVGDNEERKTVLTDSKDFDLKHPLNSKWTLWYTKPPVGDNESWSDLLRPVTSFTTVEEFWAIQNAIPKPRELPLKSDYHLFRNDIRPEWEDEANSRGGKWSFQFKVRNPPIDDLWLRALLAVIGESIDEDESEINGVVINVRRSGFKIGLWTKSVRQAPLSKVGAKFKAVLQLDDSDTLEFFAHSSANDKNAKPALVL

TIF45

Eukaryotic translation initiation factor 4E

209 amino acids

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Belongs to the eukaryotic initiation factor 4E family.

24.238 kDa

MSEELAQKTEELSLDSKTVFDSKEEFNAKHPLNSRWTLWYTKPQTNKSENWHDLLKPVITFSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIRPEWEDEANSKGGKWQFSFNKKSEVNPIINDLWLRGLLAVIGETIEDEENEVNGIVLNIRKQAYRVGIWTKDCDESKLKTVGERLKKVLQLNDEQKVEFMSHDASNTRGAEPQIVL

TIF45

Eukaryotic translation initiation factor 4E

209 amino acids

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Belongs to the eukaryotic initiation factor 4E family.

23.899 kDa

MSVDEVTKKFEETVSVDGPKTVLSDAKDFEVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQSVEEFWAIVQNIPEPHELPLKSDYHVFRNDIRPEWEDSANAKGGKWSFQVRGRGAEIDELWLRTLLAVIGETIDEEDSQINGVVLNVRKGGNRFALWTKSCDKEPLSNIGARFKQVLKLADEDTLEFFPHSTANDRHSQPTITL