TIF11

Eukaryotic translation initiation factor 1A

153 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

17.435 kDa

MGKKNTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINETDNFGFESDEDVNFEFGNADEDDEEGEDEELDIDDI

tif11

Eukaryotic translation initiation factor 1A

138 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

15.678 kDa

MPKNKGKGGKNRRRGKNENENEKRELTYAEEGQMYAQVTKMLGNGRIEAACFDGVKRLGHIRGKLRKKVWINQGDIILLSLREFQDEKGDVILKYTADEARTLKNQGELPETAKINETDTFGAEGEDDLDFEFDVDAI