TFB2

General transcription and DNA repair factor IIH subunit TFB2

515 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB2 family.

58.233 kDa

MSSSNLFKATVNEHLEGLPKQVQSRLYEAPATCLSIYRLLPPIAKFYIMTMLFYETPVALKDLDKWCKPTSRKFQFDSLKRLRALHLIEEDSSGSHIRLHPTFRQNFRDCLTGSQARNAFGNLSTTPDEQSVSIKFLDSFALQKWESILHFMVGTELSVTPSNSVLSLLKSGGLMEGTNKGGNRLNITNSGFQFLLQDINAQIWTLLLQYLNLTQDLNMDPVDVLNFIFILGSLELGKGYTVSSLSETQISMLADLRDYGLIYQRSENSERFYPTRLATTLTSDSAALKSPSMAMEQALESTTETEEQQNLASNSNQGTIILETNFKIYAYTNSPLEIAILNLFVHLKTRFSNMVCGQITRESIRNALYNGITADQIIKFLETHAHSQMKILAKERLDKKIEFDTSNNINTAGGAPQSQMMTNENGTTVAQHKLEVLPPTVVDQIKLWQLELDRIQTFEGYLFKDFASQQEFEALSNYASEIGVLLWSNKSKMKFFVTKDGISQVADFASRNQRR

TFB2

General transcription and DNA repair factor IIH subunit TFB2

514 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB2 family.

58.344 kDa

MEPTPGIIHDGHNLFKNTVNEYLQELPQPVQSRLYQSPATCLAIYRLLSPMAKFFIMSMIFQDEEVSLRDLDRWVKPDAKFQLHDAIKSMKLLHLITEGRSGQPLMVQLNSIFKESFKNALTGGEVKNSFGNVVEEENDPVTMAMLDSYAADKWETILHFMVGTPLTKSPGKNVLSLLRHSKLMEVDESSKELKITNEGFQFLLQDANAQIWTLLLQYLTMAETFQMDPVDVLNLIFMIGALELGKAYSVVGLSETQKTMLQDLRDYGLVFQKQSNLSKFYPTRLATMLTSDVVSIRSASGAVNSVLRQRAEGVDGKVLNGTALGDDDLQAGGEGALDGALIVETNFKLYSYSNSPLQIAILSLFIHLKTRFQNMVTGQITRESIRRALHNGITADQIIAYMETHAHPQMRRLAGDNLEKKLELDPNCRDTLQVLPPTVVDQIKLWQLELDRIISYDGYLFRDFDNLQEYQVLAQYARDIGVLLWSDDKKKMFFVSKEGNAQVIDFHKRKFRKK

TFB2

General transcription and DNA repair factor IIH subunit TFB2

513 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB2 family.

58.535 kDa

MSDYSLKHSVTQYLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLLDLDKWVNSNGKLQFQNAIKSMKSLHLLIPNKSSGTLMINLNPTFKISLRNALTGGEVQNSFGVVVEENVVSLDLLDEYSANKWETILHFMVGTPLAKIPSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLLQEINSQLWTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIMLQDMRDYGLVFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNREEPSVNEDGANGKSTTDITTSDDLNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKLKKKQ

TFB2

General transcription and DNA repair factor IIH subunit TFB2

504 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB2 family.

57.621 kDa

MSFSGLKHSITQYLEEIPSQVQTRLYKSPATCLAIYRLLPTLAKFFIMTVIFNDKDISLRDLDRWVKSNGKLQFQEAIKSMKSLHLLIPTRVNGQLLINLNPTFRESFRNALTGGEVNNSFGIVVDEDRLDTVVNLAVLDEYAATKWETILHFMVGTPMAKMPSENVLNLLKHSKLMEEVPDSSEFMITNEGFQFLLQEVNSQIWSLLLQYLKLAESLHMDPVHVLNFIFMLGALETGKAYSTENLSETQLKMLLDMRDYGLVFQKTSNPNIFYPTRLAQMLTSDTKSMRTASGAMESVLNKPDDAAKSTDDKYDSLEGKAEDIQDGALIIETNFKLYSYCNSPLQIAILSLFVHLKSRFANMVAGQITRESIRRALINGITADQVIAYLESHAHPQMRRLAEEKLQKKLELDPNCKDPLQVLPPTVVDQIKLWQLELDRVLTYEGSLYIDFDTAQDFNMLCKYAQDIGALLWKDDRKRKLFVSREGNAQVLEYAKRKIKKKEE

TFB2

General transcription and DNA repair factor IIH subunit TFB2

496 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB2 family.

56.741 kDa

MSLNLFKTTVNDYLEGLPEQVQSRLYESPATCLAIYRLLSPMAKFFIMSMLFQDHDVSLRDLDKWVKPDAKYQLQYSIKSMKSLNLIIEGESKQPLLIRLNPIFKKSFKNVLTGGEINNSFGDVADDDTNPVSTATLDQYSAEKWETILHYMVGTPNTNTPGGKVLDLLQHSGLMEEAEYGELKITNQGFQFLLQDVNAQMWTLLLQYLKMAESLQMDPVDVLNFIFMLGALQLGKAYKCDQLSNTQRTMLQDMRDYGLIYQNQSDYAKFYPTRLATLLTSDTKAFRSASVALDSVLNKANETTAVEGDSGQDETTERTQDGALIIETNFKLYSYSNSPLQIAILSLFVHLKSRFANMVTGQLTRESVRNALLNGITAEQIIAYLETHAHPRMRRLAEENLSKKLELDPTVKETLQVLPPTVVDQIRLWQLELDRIISYDGYLYTDFESYQEYQTVADYAKDIGVLLWQNEKKKMFFVSTEGNSQVLDFHRRNFDK

TFB2

General transcription and DNA repair factor IIH subunit TFB2

467 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB2 family.

52.631 kDa

MTSQFKNSINDYLEGLPEAVLTRLYQSPATCLAVFRLLPALARTLIMGMIFNPDPIAVADVDALVKPSSQRLKLETQKKLRLLHIFTETQAHIIINPTFKKNLRAALVGGDQNISFGVPCDTEDKHKVDVAFLDAHAVSQWEMILHFMVGTSIGRTPSDGVLNLLKHSGLMEPERGGLRITNAGFQFLLQDVNAQIWTLLLQYLNMSEYLQMDPVDVLNFIFMLGSLELGQDYSLSALSETQKHMLEDLRDYGIVYQRKASSRRFYPTRLATTLTSETAALRTASQSMEAATQDTISSSVAADSGFIILETNFRLYAYTESPLQIAVLNLFVNLKTRFANMVTGQINRDSVRFALSNGITAEQIITYLSVHAHPRMKGMEHVLPPTVVDQIKLWQLEMDRIRATDGYLFSEFKNFDEYKDVSTYAKELGVLLYENPGKRKFVSTLAGSQQIVEFVKRRNQKHRSSAN

TFB2

General transcription and DNA repair factor IIH subunit TFB2

452 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.

Belongs to the TFB2 family.

52.07 kDa

MPQVKIIAKNFMDMVASLPAIKLDKLYNNVFICEAILRSLPPLAKKYVLQMLYIDVPVPATMMEEWVLADGTSKHRVAIDRLIQLRIFSEISDRKRGTSYSLNPTFQNNLQKHIISGGVLPREPMNSDNAIKLPSLQELETYALKQWECFLLQLINSGQGEKLTGISSSMMKIFQRGLLSQRDKDGPRLTESGFQFLLMDTNAQLWYIIREYILNAEERDVDPADLISFLLELSFHVTGQAYNLNTLTEVQNNTLKDLADLGLVKLQQGRKDSWFIPTKLATNLSVSLADSSARKEGFVVMETNFRMYAYSTSKLQCEILRLFARIEYQLPNLIACAITKESLYNAFDNGITSDQIITFLQQNSHPRCADRVPSIPENVTDQIRLWETDLQRIEMTQAHFYDEFPSKDVFEAACDFAREWRGLLWEDSKRMRLVVKSEVHNQMREFLHTQSR

tfb2

General transcription and DNA repair factor IIH subunit tfb2

447 amino acids

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to TFIIK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module TFIIK controls the initiation of transcription.

Belongs to the TFB2 family.

51.192 kDa

MQAEFKSSINDFLEQLPNHARLYQKPAACLAVFRLLPILARQYVMSMLFNPMPVALSDFDLWIKLSSKVYQSESFNKLVRMHIFQFDGQYITLNSEFRKQFITALTGGGNHNSFGVPCTDEDKHLVTVDFLDAYAKETWETILHFMVGTPEAKFPGEGVLSLLKRGGLMSGPKNQLRITRAGFQFLLQDINAQIWTLLLDYLKLSEDTHMDPVQVLHFLFMLGSLDLGRAYSVDFLTDTQQIMLEDLREYGLVYQRKITSKRFYPTRLATGLTTDYRSLHGKQSENDDDKGFIIVETNYRLYAYTSSPLQIAIIGLFANLRARFSNLVVGVITRDSIRRALMNGIAAEQIITYLTTHAHPQMRSNVPLLPPTLVDQIYLWELEKNRLRATPGILFRDFLTDSGFDQAVEYAKELGVLVWDSSLKRMFFITTTGAQPMIAYLKRRAVK

tfb2

Transcription initiation factor IIB 2

332 amino acids

Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).

Belongs to the TFIIB family.

37.282 kDa

MSDTITTRTYSADAKSRDVRPRESERDETQQDETQVCPECSGHLVTDEEHGETICEDCGLVVEDTVVDRGPEWRAFDSAERDSKSRVGAPTTKMMHDKGLSTNIGWQNKDAYGKSLSPRQREQMQRLRTWNERFRTRDSKERNLKQALGEIDRMASALGLPENVRETASVIYRRALNDDLLPGRSIEGVATSALYASARMAGTPRSLDELEKVSRVDKMELTRTYRYIVRELKLEIKPADPEQYVPRFASELGLSDEAERQARQLLRDAKETGIHSGKSPVGLAAAAVYAAALLTNEKVTQSEVSTVADISEVTIRNRYKELLEVQDGTLLA

tfb2

Transcription initiation factor IIB 2

306 amino acids

Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).

Belongs to the TFIIB family.

34.481 kDa

MRGISPKRVCPICGSTEFIYDPRRGEIVCAKCGYVIEENVVDEGPEWRAFEPGQREKRARTGAPMTLMIHDKGLSTDIDWRDKDIHGNQITGMYRNKLRRLRMWQRRMRINDAAERNLAFALSELDRMAAQLRLPRHLKEVAASLYRKAVMKKLIRGRSIEGMVSAALYAACRMEGIPRTLDEIASVSKVSKKEIGRSYRFMARGLGLNLRPTSPIEYVDRFGDALGVSARTKKRAKEILNEAIKRGITSGKGPTGLAAAALYIAALLEGEKKTQREVAEVAHVTEVTVRNRYKELVEKLGINVPI