TFAM

Transcription factor A, mitochondrial

246 amino acids

Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA (By similarity).

28.907 kDa

MALLRGVWGVLNALGKSGADLCAGCGSRLRYPFSFAYVPKWFSSSLSGYPKKPMTSYVRFSKEQLPIFKAQNPDAKNSELIKKIAKLWRELPDSEKKIYEDAYRADWQVYKEEINRIQEQLTPSQMVSLEKEIMQKRLKKKALIKKRELTMLGKPKRPRSAYNIFIAERFQEARDGTSQVKLKAINENWKNLSNSQKQVYIQLAKDDKIRYYNEMKSWEEQMMEVGREDLIRRSIKYPAKNDPEKF

TFAM

Transcription factor A, mitochondrial

246 amino acids

Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation (PubMed:29445193). Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA.

29.097 kDa

MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

TFAM

Transcription factor A, mitochondrial

246 amino acids

Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA (By similarity).

28.726 kDa

MALLRGVWGVLSALGKSGADLCAVCGSRLRSPFSFAYVPRWFSSTLSGFPKKPMTSYVRFSKEQLPIFKAQNPDAKNSELIKKIAELWRELPDSEKKIYEDAYRADWQVYKEEVNRIQEQLTPSQMVSLEKEIMQKRLKKKALIKKRELTMLGKPKRPRSAYNIFIAERFQEAKDGPSQVKLKTINENWKNLSSSQKQVYIQLAEDDKVRYYNEMKSWEEQMVEVGRNDLIRRSMKHSAKKDTEEC

TFAM

Transcription factor A, mitochondrial

246 amino acids

Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA (By similarity).

28.898 kDa

MAFLRSMWGVLSALGRSGAAVCIGCGSRLRSPFSFVYLPKCFSSVLASCPKKPVSSYLRFSKEQLPIFKAENPDAKPTELIRRIAKLWRELPDSKKKIYQDAYRADWQVYKEKISRFKEQLTPSQITSLEKEIMDKHLKRKAMTKRKELTQLGKPKRPRSAYNVYVAEKFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIRLAKEDEIRYHNEMKSWEEQMIEAGRKDLLRRTIKQRQKYGAEEY

Tfam

Transcription factor A, mitochondrial

244 amino acids

Isoform Mitochondrial binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA (By similarity). Isoform Nuclear may also function as a transcriptional activator or may have a structural role in the compaction of nuclear DNA during spermatogenesis (By similarity).

28.187 kDa

MALFRGMWGVLRTLGRTGVEMCAGCGGRIPSPVSLICIPKCFSSLGNYPKKPMSSYLRFSTEQLPKFKAKHPDAKVSELIRKIAAMWRELPEAEKKVYEADFKAEWKVYKEAVSKYKEQLTPSQLMGLEKEARQKRLKKKAQIKRRELILLGKPKRPRSAYNIYVSESFQEAKDESAQGKLKLVNQAWKNLSHDEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRPPGDISEN

Tfam

Transcription factor A, mitochondrial

243 amino acids

Isoform Mitochondrial binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA. Isoform Nuclear may also function as a transcriptional activator or may have a structural role in the compaction of nuclear DNA during spermatogenesis.

27.988 kDa

MALFRGMWSVLKALGRTGVEMCAGCGGRIPSSISLVCIPKCFSSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH