TESC

Calcineurin B homologous protein 3

214 amino acids

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin (By similarity).

Belongs to the calcineurin regulatory subunit family. CHP subfamily.

25.051 kDa

MGSAQSVPPEMRALAERTGFTSEQIEQLHRRFKQLNHNRKTIRKEDFDTIPDLEFNPIRARIVHAFFDKRNLRKAPAGLAEEINFEDFLTIMSYFRPIEMDMDEERLESFRKEKLKFLFHMYDADYDGIITLQEYKNVLDELMSGNPHLEKESLRAIAEGAMLEAASACMARTGPDEVYEGITFEDFLKVWKGIDIETKMHVRFLTMEAIAHCY

TESC

Calcineurin B homologous protein 3

214 amino acids

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.

Belongs to the calcineurin regulatory subunit family. CHP subfamily.

24.75 kDa

MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH

Tesc

Calcineurin B homologous protein 3

214 amino acids

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.

Belongs to the calcineurin regulatory subunit family. CHP subfamily.

24.6 kDa

MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSSGLADEINFEDFLTIMSYFRPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCVGQMEPDQVYEGITFEDFLKIWQGIDIETKMHIRFLNMETIALCH

tesc

Calcineurin B homologous protein 3

214 amino acids

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin (By similarity).

Belongs to the calcineurin regulatory subunit family. CHP subfamily.

24.826 kDa

MGLSHSHSVETRELVEKTGFSAEQIEHLHKRFKSLSGDEPTIRRGHLNDISDLVLNPIRSKIIDAFFDKRNLRKGPSGYVEEINFEEFLIIMSYFRPLSQHMDEENISVCRTDKLRFLFNMYDSDNDNKITLEEYRKVVEELLSGNPNIEKEMARSIADGAMLEAASICVGQMEPDQVYEGITFDDFLKIWEGIDIETKMHIRFLNMESIPSCR

tesc

Calcineurin B homologous protein 3

214 amino acids

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin (By similarity).

Belongs to the calcineurin regulatory subunit family. CHP subfamily.

24.666 kDa

MGLSHSHSVETRQLVEKTGFSAEQIEHLHKRFNSLSGDLLTIRKGHLNGISDLEVNPIRSKIVDAFFDKRNLRKGSSGYVEEINFEEFLTIMSYFRPLSQNMDEENISVCRKDKLRFLFNMYDTDNDSKITLEEYRKVVEELLSGNPNIEKETARSIADGAMLEAASICVGQMEPDQVYEGITFDDFLKIWEGIDIETKMHIRFLNMESIPSCR