Function
Cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs during oocyte maturation. Plays a central role during oocyte maturation by mediating polyadenylation of dormant mRNAs, which contain 5'AAUAAA-3' sequence in their 3'-UTR. In immature oocytes, polyadenylation of poly(A) tails is counteracted by the ribonuclease parn. During maturation parn is excluded from the ribonucleoprotein complex, allowing poly(A) elongation and activation of mRNAs. May not play a role in replication-dependent histone mRNA degradation (By similarity).
Sequence
MYPNSPSQGRIPLPLPCEQQQPPLEQSQEQPLQPQPLQPQQASGYLSKLPVSVAPELLSPEQFIQASINLHNNVNFARMLMNANLLAVPPVSPPPWSYRDQSPLISPASPSSSFQNRKRRSDEGNIAYDVKRQKFQSPQEQTVNHQAVPLRGDLGCSYPGSPAFPLLQSPSPPVLKGHVPNSGECWLYDHVDTTLPVAKDKLSKQILELFQALQQQVCDLKKKDICRAELQREIQQIFPQSRLYLVGSSLNGFGTRSSDADLCLVLKDEPMNQHTEARHILSLLHKHFYTRLSYIERPQFIKAKVPIVKFRDKVSGAEFDLNVNNVVGIRNTFLLRTYAYIENRVRPLVLVIKMWANYHGLNDASRGTLSSYTLVLMALHYLQTLPEPIIPSLQKKYPECFDSTMQLHLVHHAPRNIPKYLSKNETPLGDLLLGFLKYFAIEFDWSKDIISVREAKALPRSDDYEWRNKFICVEEPYDRTNTARAVYERQKFDMIRAEFLRAWVALRDNRDLYSLLPWKGIMKKMNSL