TAS2R46

Taste receptor type 2 member 46

309 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency (By similarity).

Belongs to the G-protein coupled receptor T2R family.

35.567 kDa

MITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYATELNPAFYSIEVRITAYNVWAVISHFSNWLATSLSIFYLLKIANFSNLIFLRLKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSDTTVTILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAIYFLSVIMSVWSFESLENKPVFMFCEAITFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYWVKGEKPSSS

TAS2R46

Taste receptor type 2 member 46

309 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency (By similarity).

Belongs to the G-protein coupled receptor T2R family.

35.523 kDa

MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLVLNWYATELNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLHLKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVTILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAIYFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYWVKGEKPSSS

TAS2R46

Taste receptor type 2 member 46

309 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency (By similarity).

Belongs to the G-protein coupled receptor T2R family.

35.644 kDa

MITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYATELNPAFYSIEVRITAYNLWAVINHFSNWLATSLSIFYLLKIANFSNLIFLRLKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNITVTILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAIYFLSIIMSVWSFESLENKPVFMFCEAITFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYWVKGEEPSSP

TAS2R46

Taste receptor type 2 member 46

309 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency (By similarity).

Belongs to the G-protein coupled receptor T2R family.

35.603 kDa

MITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYATELNPAFYSIEVRITAYNLWAVINHFSNWLATSLSIFYLLKIANFSNLIFLCLKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVTILANLVPFTLTLISFLLLICSLCKHLEKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAIYFLSIIMSVWSFESLENKPVFMFCEAITFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYWVKGEKPSXP

TAS2R46

Taste receptor type 2 member 46

309 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency (By similarity).

Belongs to the G-protein coupled receptor T2R family.

35.35 kDa

MITFLPITFSILIVVIFFIGNFANGFIALINSIEWVKRQKISFAGQILTALAVSRVGLLWVLSLHWYATEFNLAFHSVEVRSTAYNVWVVTNHFSNWLSTSLSMFYLLRIATFSNLIFLHLNRRVKSVILVTLLGPLLFLVCQLFVMNMNQIVRTKEYEGNMTWKIKLKSAMYLSNTTVAMLANFVPLTLTLISFLLLICSLCKHLKKMRVHGKGSQDPSTKVHTKALQIVTSFLLVCAIYFLSIILSVWNSGGLENKPFFMFCQAIKFSYPSTHPFILIWGNKTLKQTFLSVLRNVRYWVKGQKPSSP

TAS2R46

Taste receptor type 2 member 46

308 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity). In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency (By similarity).

Belongs to the G-protein coupled receptor T2R family.

35.462 kDa

MITFLSITFSILVGVIFVIGNFANGFIALVNSIEWVKRQKISFADQILTGLAVSRVGLLWVLLLHLYATEFNLAFYSVEVRITAYNVWIVTNHFSNWLSTSLSMFYLLKIATFSNLIFLHLKRKVKSVILVTLLGPLLFLVCHLFVMNMNHIVWRKEYEGNITWRIKLRSAMYLSNVTVTMLANLIPLTLTLMSFLLLICSLCKHLKKMQVHGKGSQDPSTKVHIKALQTVTSFLLLCAIYFLSMILSVWNFELEKKPVFMFCQAVIFSYPSTHPLILIWGNKKLKQIFLSVLWNVRYWVKGQKPSSP