TAS2R39

Taste receptor type 2 member 39

338 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).

Belongs to the G-protein coupled receptor T2R family.

38.622 kDa

MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINIXTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKATSYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL

TAS2R39

Taste receptor type 2 member 39

338 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).

Belongs to the G-protein coupled receptor T2R family.

38.626 kDa

MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL

TAS2R39

Taste receptor type 2 member 39

338 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).

Belongs to the G-protein coupled receptor T2R family.

38.542 kDa

MLGRCFPPNTKEKQQLRMIKLCDPAESELSPFLITLTLAVLLAEYLTGIIANGFITAIHAAEWVQNKSVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRISGLIPWLLWLSVFISFSHSMFCINICTGYCDNSFPIHSSNSTEKTYFSEISVVSLAFFFNLGIVIPLIMFILAAILLILSLKRHTLHMGSNATGSKDPSMEAHIGAIKATSYFLILYIFNAVALFIYLSNMFDINSLWNTLCQIIMAAYPASHSILLIKDNPGLRRAWKQLQHRLHLYPKQWTL

TAS2R39

Taste receptor type 2 member 39

338 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).

Belongs to the G-protein coupled receptor T2R family.

38.58 kDa

MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIMAAYPAGHSILPIQDNPGLRRAWKRLQLRLHLYPKEWTL

TAS2R39

Taste receptor type 2 member 39

338 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).

Belongs to the G-protein coupled receptor T2R family.

38.58 kDa

MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIMAAYPAGHSILPIQDNPGLRRAWKRLQLRLHLYPKEWTL

TAS2R39

Taste receptor type 2 member 39

338 amino acids

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity).

Belongs to the G-protein coupled receptor T2R family.

38.57 kDa

MLGRCFPPNTKEKQQLRMIKLCDPAESELSPFLITLTLAVLLAEYLTGIIANGFITAIHAAECVQNKSVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDTVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRISGLIPWLLWLSVFISFSHSMFCINICTGYCDNSFPIHSSNSTEKTYFSEISVVSLAFFFNLGIVIPLIMFILAAILLILSLKRHTLYMXSNATGSKDPSMEAHIGAIKATSYFLILYIFNAVALFIYLSNMFDINSLWNTLCQIIMAAYPASHSILLIKDNPGLRRAWKQLQHRLHLYPKEWTL

Tas2r39

Taste receptor type 2 member 39

319 amino acids

Putative taste receptor which may play a role in the perception of bitterness.

Belongs to the G-protein coupled receptor T2R family.

36.308 kDa

MAQPSNYWKQDVLPLSILMLTLVATECTIGIIASGIVMAVNAVSWVQKKAISITTRILLLLSVSRIGLQSIMLIEITSSIFNVAFYNSVLYRVSNVSFVFLNYCSLWFAALLSFFHFVKIANFSYPLFFKLKWRISELMPWLLWLSVFISFSSSMFFSKHKFTVNNNNSLSNNICNFTMKLYVVETNVVNVSFLFISGILPPLTMFVATATLLIFSLRRHTLNMRNSATGSRNPCIEAHMQAIKETSCFLFLYILNAAALLLSTSNIVDASLFWSIVIRIVLPVYPAGHSVLLIQNNPGLRRTWKHLQSQIHLYLQNRF

Tas2r39

Taste receptor type 2 member 39

319 amino acids

Putative taste receptor which may play a role in the perception of bitterness.

Belongs to the G-protein coupled receptor T2R family.

36.42 kDa

MAQPSNYWKQDLLPLSILILTLVATECTIGIIASGIITVVNAVSWVQKRAVSITTRILLLLSVSRIGLQSIILIEMTSSIFNFSSYNSVLYRVSRVSFVFLNYCSLWFAALLSFFHFVKIANFSYPLFFKLKWRISELMPWLLWLSVFISFSSSMFFCNHKYTVYNNISLSSNICNFTMELYVAEANVVNVAFLFSFGILPPLTMFIATATLLIFSLRRHTLHMRNGDADSRNPRVEAHKQAIKETSCFLFLYILYAAVLFLSTSNIADASLFWSSVLRISLPVYPAGHSVLLIQSNPGLKRTWKQLLSQIHLHLQSRY