SOX3

Transcription factor SOX-3

446 amino acids

Transcription factor required during the formation of the hypothalamo-pituitary axis. May function as a switch in neuronal development. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. Required also within the pharyngeal epithelia for craniofacial morphogenesis. Controls a genetic switch in male development. Is necessary for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells (By similarity).

45.21 kDa

MRPVRENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGLFTVAAPAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGTPTQAAGTGGPAAPGGAGKSSANAAGGANSGGGSSGGASGGGGGTDQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLLKKDKYSLPSGLLPPGAAAAAAAAAAAAAAASSPVGVGQRLDTYTHVNGWANGAYSLVQEQLGYAQPPSMSSPPPPPALPPMHRYDMAGLQYSPMMPPGAQSYMNVAAAAAAASGYGGMAPSATAAAAAAYGQQPATAAAAAAAAAAMSLGPMGSVVKSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNGTVPLTHI

Sox3

Transcription factor SOX-3

375 amino acids

Transcription factor required during the formation of the hypothalamo-pituitary axis. May function as a switch in neuronal development. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. Required also within the pharyngeal epithelia for craniofacial morphogenesis. Controls a genetic switch in male development. Is necessary for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells.

37.789 kDa

MYSLLETELKNPVGPPTPAAGTGVPAAPGAAGKSGANPAGGANAGNGGSGGANGGGGGGGGGGSDQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLLKKDKYSLPGGLLPPGAAAAAAAAAAAAAASSPVGVGQRLDTYTHVNGWANGAYSLVQEQLGYAQPPSMSSPPPPPALPQMHRYDMAGLQYSPMMPPGAQSYMNAAAAAAAASGYGGMAPSAAAAAAAAYGQQPATAAAAAAAAAAMSLGPMGSVVKSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNGTVPLTHI

SOX3

Transcription factor SOX-3

312 amino acids

Transcription factor that may function as a switch in neuronal development. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation.

34.456 kDa

MYSMLETEIKTPQPTRAARGEPARAATAKVGGAAAADGCRSDQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLLKKDKYSLPGNLWPPGSAGAAAVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYGQHPGMNSPQLQQMHRYDMPGLQYSPMMSTAQTYMNAGLHLQHVPRPYGQQPSTAMSLGSMGSVVKSEPSSAPPAITSHSQRACLGELRDMISMYLGPGGDATHPSALQGSRLHSVHQHYQSAGTRVNGTVPLTHI

sox3

Transcription factor Sox-3

307 amino acids

Transcription factor with sequence-specific DNA binding activity. Binds to the consensus sequence 5'-[AT][AT]CAA[AT]G-3', showing a preference for 5'-AACAAT-3' and 5'-AACAAAG-3'. Inhibits beta-catenin-mediated dorsal axis specification by binding to sites within the promoter of the beta-catenin-regulated gene nodal5. Maternally derived sox3 acts as a transcriptional repressor of nodal5 and nodal6 to restrict their expression to the vegetal hemisphere of early embryos and thus establish germ layer formation. Acts at multiple points to inhibit nodal signaling, repressing the expression of the other mesoderm-inducing nodal genes nodal, nodal2 and nodal4, and also acting downstream to induce expression of genes including trim33/ectodermin, ema and coco, whose products repress nodal signaling (By similarity).

33.78 kDa

MYSMLDTDLKSPVQQSNAPNGGPGTPGGKGNASIPDQERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDSEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLLKKDKYSLPGNLLAPGVSPVASSVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYSQHPGMNSPQMQQIQHRYDMGGLQYSPMMSSAQTYMNAAASTYSMSPAYNQQSSTVMSLGSMGSVVKSEPSSPPPAITSHTQRACLGDLRDMISMYLPPGGDASDPSSLQSSRLHSVHQHYQSAAGPNGTVPLTHI

sox3

Transcription factor Sox-3

300 amino acids

Transcriptional activator.

33.417 kDa

MYNMMETEIKSPIPQSNTGSVTGGKNNSANDQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKYSLPGGLLAPGANAVNNAVSVGQRMDYTHMNGWTNSAYSLMQDQLAYPQHPSMNSPQIQQMHRYDMAGLQYPMMSTAQTYMNAASTYSSMSPAYTQQTSSAMGLGSMASVCKTEPSSPPPAITSHSQRACLGDLRDMISMYLPPGGDSADHSSLQTSRLHSVHPHYQSAGTGVNGTLPLTHI