Sgf11

SAGA-associated factor 11 homolog

220 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription.

Belongs to the SGF11 family.

23.9 kDa

MSTGTANSAVSSKSTNSTTSTSKVPVNEKSNNSQNANTSTASIIKSYREIVNDPKNLDEAANYLYQSLLDDAVVGVFLEIHHLRKTGNLTAMDGVNEDESETSFRIVDMPNFDIFGISTAKKPMDCTCPNCDRPVSAARFAPHLEKCMGMGRISSRIASRRLATKESNSASSSSSSSYLQTTNAGSDDEDDVDWSSEKRRKKSSQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

211 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

22.599 kDa

MSASNATHTHLSSSGGASQMATTQGHLTASAITLNFRELIKEPKGLEDAANYLFQGLLDDVVAGIFIEIHHLRKTGNLTALDGVGEENAESAYRICEMPNLDIFGISTAKKPMDCTCPHCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGASASSSSTSTYIQSGGNTGGTDDEDDVDWSSDKRKKKSTQNSRNNGSKKNNGKIF

Sgf11

SAGA-associated factor 11 homolog

196 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

21.292 kDa

MSAANMPTTTGAQGSGNQVPTTSTTIVNHFRELIKDPKNLDEASNYLFQTLLDDAVVGIFNETHHLRKSGNLAALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATSAHLHSAGNTGGTDDEDDVDWSSDKRRKKSNQNSRNNGSKKNNGKSF

Sgf11

SAGA-associated factor 11 homolog

196 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

21.322 kDa

MSAANMPTTTGAQGSGNQVPTTSTTIVNHFRELIKEPKNLDEAANYLYQSLLDDAVVGIFNETHHLRKSGNLAALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDWSSDKRRKKSNQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

196 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

21.047 kDa

MPTSAAPVPAVAAQSPTTRKAIANNFRELTKDPKKLDEAANQLYESLLEDAVTGIFIEVHHLRKIGNLSALDGVAEESAHRICDVPNLDIFGVSTAKKAIDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGTSASSNSSYVHSGANAGGTDDEDDVDWSSDKRKKKSTQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

196 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

21.047 kDa

MPTSAAPVPAVAAQSPTTRKAIANNFRELTKDPKKLDEAANQLYESLLEDAVTGIFIEVHHLRKIGNLSALDGVAEESAHRICDVPNLDIFGVSTAKKAIDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGTSASSNSSYVHSGANAGGTDDEDDVDWSSDKRKKKSTQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

196 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

21.32 kDa

MSAANMPTTTGAQGSGNQVPTTSTTIVNHFRELIKEPKNLDEAANYLFQTLLDDAVVGIFNETHHLRKSGNLAALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDWSSDKRRKKSNQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

196 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

21.276 kDa

MSAANMPTTTGAQGSGNQVPTTSTTIVNHFRELIKDPKNLDEASKYLFQTLLDDAVVGIFNETHHLRKSGNLAALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGASSAHLHSAGNAGGTDDEDDVDWSSDKRRKKSNQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

195 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

21.228 kDa

MSAANMPTTTGAQGSGNQVPRTSTTIVNHRELIKEPKNLDEAANYLFQTLLDDAVVGIFNETHHLRKSGNLAALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDWSSDKRRKKSNQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

191 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

20.689 kDa

MPTTPSAQGSGNQNTATSQQIVNNFRELIKDPKSLDEAVNYMYQTLLDDAVAGIFIETHHLRKTGNLSALDGVAEDSTYRICEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGSSAALLHSGGNAGGTDDEDDVDWSSDKRKKKSSQSSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

189 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.

Belongs to the SGF11 family.

20.562 kDa

MAQGHTTASAILHNFRELIKEPKGLDDAANYLFQGLLDDVVAGIFIEIHHLRKTGNLTALDGVGEENAESAYRICEMPNLDIFGISTAKKPMDCTCPNCDRLVAATRFAPHLEKCMGMGRISSRIASRRLATKEGSSASSTSTSTYLQSGNTGGTDDEDDVDWSSDKRKKKSTQNSRNNGSKKNNGKTF

Sgf11

SAGA-associated factor 11 homolog

183 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription.

Belongs to the SGF11 family.

20.451 kDa

MSESEPVHIEYADETELLTEFRNFMSDPDTREKAANYLLNSLIDESILGIVFEVHHAYKTGSVAAIEGQPEDPKSFTIVDMPDMDVFGSTNSKKAIDCSCPNCNRIVAASRFAPHLEKCMGMGRNSSRIASRRIANTRDGGNYFGADEDDEDDADWSGEKRKKKIAPVRTNGSKKNVMKIYFL

Sgf11

SAGA-associated factor 11 homolog

182 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription.

Belongs to the SGF11 family.

20.312 kDa

MSENDGIHIEYVDEQELKREFRRFMSDPETREKAANYLYESLVDETILGIAYEVHHANKTGSGAAVEGEPEDSKPYTIVDQPDTDVFGSSNTKKAIDCHCPNCNRIVAASRFAPHLEKCMGMGRNSSRIASRRIANTRDVGTGNYFGGDEDDEDDADWSGEKRKKKISQVRTNGSKKNGKTS

SGF11

SAGA-associated factor 11

181 amino acids

Component of a deubiquitination module (DUB module) that specifically deubiquinates monoubiquinated histone H2B (H2Bub) (PubMed:29588169, PubMed:30192741). Does not seem to be a component of the TREX-2 complex (PubMed:29588169). Seems to act independently of the SAGA multiprotein complex (PubMed:30192741). The DUB module is responsible for the major H2Bub deubiquitinase activity in Arabidopsis (PubMed:30192741).

Belongs to the SGF11 family.

19.677 kDa

MSGAEDNKSSHAQLSSQIFLDLVDSVIADVASECHRVARLGLDRDLDIVEEELRLSVEARAKIADPSNNLETNTKYVVDIFGQTHPPVASEVFNCMNCGRQIVAGRFAPHLEKCMGKGRKARAKTTRSTTAAQNRNARRSPNPRYSPYPNSASENQLASGSPGVAGEDCSNFTVRENVKGD

Sgf11

SAGA-associated factor 11 homolog

180 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription.

Belongs to the SGF11 family.

19.929 kDa

MGENEPIHIEYADETELLTEFRQYMADPDTREKAANYLLDSLVDEMILGVVFEVHHAYKTGSGAAIEGQPEDCKPYTIVDLPDMDVFGSSNSKKAIDCSCPNCNRIVAASRFAPHLEKCMGMGRNSSRIASRRIANTRDGGNYFGADEDDEDDADWSGEKRKKKIAPVRTNGSKKNGKTS

SGF11

SAGA-associated factor 11

120 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

13.24 kDa

MTSTPITYKTLADSIFNDLINNIIKQHTLTSLTNIKDHSSLLNSSNSNTNSNTNGTIASNGGNGTTSDENNEIENSTIQDKSKLKQLETSRYFRCLNCGRNIAGGRFASHISKCLERKRK

sgf11

SAGA-associated factor 11

117 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

13.139 kDa

MQPASLAGISCTIFENLLKDYTHELTQTVHKNAKLSLQKCPACNKHCRQYCTKPGYDIYGNSVQTPSNVPYYSCLMCKREIAASRYAAHLEKCKGRSLSNATSYSTLFEDDNADEED

SGF11

SAGA-associated factor 11

105 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

11.831 kDa

MTLGRDAMTPLTILSVSETIYHNLLTSMVQDIVSRTTSRQQLQDARYPGLAPLHHDQRGALDVYGRPKPQEASVYFRCPNCSRDLSANRFAAHLERCMSRGARRG

SGF11

SAGA-associated factor 11

102 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

11.553 kDa

MTEQPITLDLVDIVDNIVRKQTLSSFARHVSVQSQTLGNHDTNVPVISNFAVGSNKDIFNQDKTKLKTSEASRYFSCENCGRKIAGGRYAQHVNKCLERRRR

SGF11

SAGA-associated factor 11

100 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

11.562 kDa

MTEKPVTYQSLDMLDNILRQQTLASVSRYRSLKSTLGENEKKSVFIDDIMSSSKDIYGQDKQKLKVSETSKYFQCENCGRSIAGGRFAQHMTKCLERRRK

SGF11

SAGA-associated factor 11

99 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

11.333 kDa

MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFYPNGSLDINGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR

SGF11

SAGA-associated factor 11

99 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

11.285 kDa

MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDINGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR

SGF11

SAGA-associated factor 11

99 amino acids

Component of the transcription regulatory histone acetylation (HAT) complex SAGA. SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3 and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SGF11 is involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex with SUS1, SGF73 and UBP8 required for deubiquitination of H2B and for the maintenance of steady-state H3 methylation levels. It is required to recruit UBP8 and SUS1 into the SAGA complex.

Belongs to the SGF11 family.

11.285 kDa

MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDINGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR

SGF11

SAGA-associated factor 11

99 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

11.531 kDa

MTEQHETIQSVTDGIYNNLVTSMIHSIVSKETAREKLLRSRYGSYKQYHYDPNSQLDIHGNPKQQDSSQYFYCENCGREVSGNRFAAHLQRCLTRGSRR

SGF11

SAGA-associated factor 11

97 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

10.757 kDa

MTASLTTDSVADSIYQNILTSIIQDIISRQTVKRKLLKLQFPDAKPYYADPSGTLDIHGKAKQADSAVYIECNVCGREVSGNRFAAHLVRCLSRGRR

SGF11

SAGA-associated factor 11

96 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

11.167 kDa

MTQSIDSMSISIYENLISTMIQDIVSREVVHQKQMQSRYPQLKQYSIDPNGNIDINGNTKQQDSSQYFHCKNCGRDVSANRFAAHLQRCLNSRQRR

SGF11

SAGA-associated factor 11

90 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Involved in transcriptional regulation of a subset of SAGA-regulated genes. Within the SAGA complex, participates in a subcomplex, that specifically deubiquitinates histones H2B.

Belongs to the SGF11 family.

10.135 kDa

MINNIIRNQVVTHFADHACMAQATVSIPELDKLATNLQLADTNKDIFGQDRSKLKGIEASRYFSCDNCGRKIAGGRFAQHINKCLDRKRK