About Products Protein Database Contact

Saci_1565

Gene
Saci_1565
Protein
Digeranylgeranylglyceryl phosphate synthase
Organism
Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Length
275 amino acids
Function
Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). This reaction is the second ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Similarity
Belongs to the UbiA prenyltransferase family. DGGGP synthase subfamily.
Mass
30.128 kDa
Sequence
MSVKAYLELIRVHNVVGSAVSAFMGYVIATTWKFTPLFFLPLLVVSLIAAGGYVINDVYDIEVDKINKPERPLPSGRIAVNIARRFSIVLFAVGLIISIPLGLIPFGFALITIVLLYEYARSLKKLGLVGNFIVALTSALSAYYGGLASGSLLGNFIIPTIYIFFFTLSREFVKGIEDIEGDKRNGVNTLAVKLGEKSTWIIAKIILGILIFTSPLPYFLGFNVIYLIGILALDVLLVYILILHNTIESATKARSLMKIYAIGTLIVFTLGSLRI