SWF7

Protein J1 homolog

95 amino acids

Late protein which is a part of a large complex required for early virion morphogenesis. This complex participates in the formation of virosomes and the incorporation of virosomal contents into nascent immature virions. J1 protein is required for DNA packaging during immature virions (IV) formation (By similarity).

Belongs to the chordopoxvirinae J1 family.

11.271 kDa

single

KLESIGYLYEPLSEEYRRVIDFSDMKNLRSMFNKITIHVSDKCIQVNKGYLSDFVTSLIRLSDSDINTYDSFDITYIDPRRHITWNNILSILNEK