About Products Protein Database Contact

SUR7

Gene
SUR7
Protein
Protein SUR7
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
302 amino acids
Function
Involved in sporulation and affects the sphingolipid composition of the plasma membrane. Probably involved in endocytosis.
Similarity
Belongs to the SUR7 family.
Mass
33.83 kDa
Sequence
MVKVWNIVLRLVVLLFLAGNTLLLILMIISGATDHYPVNRFYWVQGNTTGIPNAGDETRWTFWGACLQDKDGSDTCTSNLAPAYPISPVDNFNTHINVPHQFISKRDAFYYLTRFSFCFFWIALAFVGVSFILYVLTWCSKMLSEMVLILMSFGFVFNTAAVVLQTAASAMAKNAFHDDHRSAQLGASMMGMAWASVFLCIVEFILLVFWSVRARLASTYSIDNSRYRTSSRWNPFHREKEQATDPILTATGPEDMQQSASIVGPSSNANPVTATAATENQPKGINFFTIRKSHERPDDVSV

Gene
SUR7
Protein
Protein SUR7
Organism
Candida albicans (strain SC5314 / ATCC MYA-2876)
Length
270 amino acids
Function
Involved in cell wall, plasma membrane, and cytoskeletal organization. Plays a role in endocytosis and hyphal morphogenesis. Required to restrict septin proteins to the bud neck and prevents intracellular growth of cell wall. Contributes to secretion, biofilm formation, and macrophage killing. Essential for resistance to stressful conditions and for invasive growth and virulence.
Similarity
Belongs to the SUR7 family.
Mass
29.916 kDa
Sequence
MKVVFTFFNLFFLAGTVLLLIFTVLSGSSKHFPLNKFYWLEADTSGIKNAPANRSAWTFWGVCDKADYSNCLLGPAYPISPEDNFGTTADIPKDFVDNENTYYYLSRFAFAFCLIALAFSGLAFIIDILGFCFEIIDKVVIFLITIGLLFLAGFASLQTAVVVLAKNAFKNDGRYAHIGAKSMGIMWAAFACLLICWLLIFAGTISNSYKKHIARVKAEQGQYSQPTHGPAGDESSFTRAAPPTKDEENTGGIRFFKIKRNQKVSDDESV